Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5343
Gene name
LocationContig_521:1341..2539
Strand+
Gene length (bp)1198
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 3.0E-33 58 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 61 364 1.0E-24
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 32 352 2.0E-23
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 57 364 7.0E-23
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 53 364 1.0E-19
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 79 349 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 61 364 1.0E-24
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 32 352 2.0E-23
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 57 364 7.0E-23
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 53 364 1.0E-19
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 79 349 6.0E-19
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 70 348 3.0E-18
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 6 352 8.0E-18
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 52 346 2.0E-17
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 19 363 7.0E-17
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 55 362 1.0E-16
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 70 352 3.0E-15
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 55 353 3.0E-15
sp|Q9LF61|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana GN=XPT PE=1 SV=1 8 349 3.0E-14
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 15 342 4.0E-14
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 57 345 3.0E-13
sp|Q8CD26|S35E1_MOUSE Solute carrier family 35 member E1 OS=Mus musculus GN=Slc35e1 PE=1 SV=2 115 353 5.0E-13
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 60 355 1.0E-12
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 4 355 1.0E-12
sp|P0C6B1|S35E1_RAT Solute carrier family 35 member E1 OS=Rattus norvegicus GN=Slc35e1 PE=3 SV=1 115 353 1.0E-12
sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 115 353 2.0E-12
sp|Q94B38|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=2 4 344 2.0E-12
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 65 363 2.0E-12
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 54 355 4.0E-12
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 61 342 4.0E-12
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 19 342 1.0E-11
sp|Q8H0T6|PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=PPT2 PE=2 SV=1 59 344 1.0E-11
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 65 363 2.0E-11
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 23 353 3.0E-11
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 79 362 5.0E-11
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 136 351 1.0E-10
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 61 350 1.0E-10
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 65 363 2.0E-10
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 17 362 3.0E-10
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 61 355 5.0E-10
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 3 355 7.0E-10
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 3 355 1.0E-09
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 61 352 1.0E-09
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 128 359 2.0E-09
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 73 362 2.0E-09
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 61 219 2.0E-09
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 61 351 8.0E-09
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 61 198 9.0E-09
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 65 363 1.0E-08
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 51 359 2.0E-08
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 61 363 3.0E-08
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 70 362 2.0E-07
sp|Q6ICL7|S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens GN=SLC35E4 PE=2 SV=1 72 353 4.0E-07
sp|Q5M8T2|S35D3_HUMAN Solute carrier family 35 member D3 OS=Homo sapiens GN=SLC35D3 PE=2 SV=1 79 364 1.0E-06
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 119 356 1.0E-06
sp|Q8K3D6|S35E4_MOUSE Solute carrier family 35 member E4 OS=Mus musculus GN=Slc35e4 PE=2 SV=2 119 352 1.0E-06
sp|Q5RKL7|S35E4_RAT Solute carrier family 35 member E4 OS=Rattus norvegicus GN=Slc35e4 PE=2 SV=1 72 344 3.0E-06
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 71 364 4.0E-06
sp|Q8BGF8|S35D3_MOUSE Solute carrier family 35 member D3 OS=Mus musculus GN=Slc35d3 PE=2 SV=1 79 362 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 55 72 17
2 79 101 22
3 116 138 22
4 159 181 22
5 191 210 19
6 264 286 22
7 296 318 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5343
MARLSGDEPVALLRSEEQDAEFKAEVRDVESDAGSDPLPTQNLDHEYSIPSTVKFTWLGTYFFFSLLLTLYNKLV
LGMFSFPWLLTCLHASFASLGTYAMMHLGYFKLSRLGRREYLALLAFSALFTANIALSNLSLAMVSVPFYQTMRM
LCPIFTILIYRVWYSRTYSGMTYLSLVPLIVGAAMTTAGEMTFTDAGFLLTILGVVLAAVKTVVTNRFMTGSLAL
PPIEFLMRMSPLAALQALACATVTGEVAGFRDLITSGNIALGPALASLGGNGFLAFLLNIASFQTNKLAGALTMT
VCGNLKQCLTVLIGIFMFRISVDMLNGAGMGVTMIGAAIYSKAELDNRRKSRQPAYQALEQKPR*
Coding >Ophun1|5343
ATGGCTCGCCTGAGCGGCGACGAGCCCGTGGCCCTTCTCAGGTCCGAGGAGCAAGACGCCGAGTTCAAGGCAGAA
GTCCGCGACGTCGAGAGCGATGCCGGTTCCGATCCTCTTCCCACCCAAAACCTCGATCACGAGTACTCCATACCC
AGCACCGTCAAGTTCACATGGCTCGGCACCTACTTCTTCTTTTCCCTGCTCCTCACCCTCTATAACAAGCTCGTA
CTGGGCATGTTCTCCTTTCCTTGGCTTCTCACCTGCCTCCACGCCTCGTTCGCAAGCTTGGGAACCTACGCCATG
ATGCACCTGGGCTACTTTAAGCTCTCGCGACTGGGACGGCGCGAATACCTGGCCCTCCTCGCCTTCAGCGCCCTC
TTCACCGCAAACATCGCCCTCTCCAACCTTTCGCTGGCCATGGTGTCGGTGCCCTTTTACCAGACGATGCGCATG
TTGTGCCCCATCTTCACCATTCTCATCTACCGCGTCTGGTACAGCCGCACCTACAGCGGCATGACGTATCTGTCC
CTGGTTCCCCTCATCGTCGGCGCTGCCATGACGACGGCTGGCGAGATGACGTTTACCGATGCCGGCTTCCTCCTC
ACCATACTCGGCGTTGTCCTCGCCGCGGTCAAGACCGTCGTCACGAACCGATTCATGACGGGCTCGCTGGCCCTA
CCTCCGATCGAATTTCTGATGCGCATGTCGCCACTGGCAGCTCTGCAGGCACTGGCATGCGCCACCGTGACGGGC
GAGGTGGCTGGCTTCCGCGACCTCATTACATCTGGAAACATCGCCCTCGGCCCCGCTCTGGCGTCGCTGGGTGGC
AATGGATTCCTCGCCTTTCTCCTCAACATTGCGTCCTTCCAAACCAACAAGCTGGCTGGTGCCCTGACGATGACG
GTGTGCGGCAACCTGAAGCAATGCCTGACGGTCCTGATTGGAATCTTCATGTTCAGGATTTCCGTCGACATGCTC
AATGGAGCGGGCATGGGCGTCACCATGATTGGTGCCGCCATCTACAGCAAGGCAGAGTTGGACAACAGGAGGAAA
AGCCGGCAACCGGCTTACCAGGCCCTGGAGCAGAAGCCCAGGTAG
Transcript >Ophun1|5343
ATGGCTCGCCTGAGCGGCGACGAGCCCGTGGCCCTTCTCAGGTCCGAGGAGCAAGACGCCGAGTTCAAGGCAGAA
GTCCGCGACGTCGAGAGCGATGCCGGTTCCGATCCTCTTCCCACCCAAAACCTCGATCACGAGTACTCCATACCC
AGCACCGTCAAGTTCACATGGCTCGGCACCTACTTCTTCTTTTCCCTGCTCCTCACCCTCTATAACAAGCTCGTA
CTGGGCATGTTCTCCTTTCCTTGGCTTCTCACCTGCCTCCACGCCTCGTTCGCAAGCTTGGGAACCTACGCCATG
ATGCACCTGGGCTACTTTAAGCTCTCGCGACTGGGACGGCGCGAATACCTGGCCCTCCTCGCCTTCAGCGCCCTC
TTCACCGCAAACATCGCCCTCTCCAACCTTTCGCTGGCCATGGTGTCGGTGCCCTTTTACCAGACGATGCGCATG
TTGTGCCCCATCTTCACCATTCTCATCTACCGCGTCTGGTACAGCCGCACCTACAGCGGCATGACGTATCTGTCC
CTGGTTCCCCTCATCGTCGGCGCTGCCATGACGACGGCTGGCGAGATGACGTTTACCGATGCCGGCTTCCTCCTC
ACCATACTCGGCGTTGTCCTCGCCGCGGTCAAGACCGTCGTCACGAACCGATTCATGACGGGCTCGCTGGCCCTA
CCTCCGATCGAATTTCTGATGCGCATGTCGCCACTGGCAGCTCTGCAGGCACTGGCATGCGCCACCGTGACGGGC
GAGGTGGCTGGCTTCCGCGACCTCATTACATCTGGAAACATCGCCCTCGGCCCCGCTCTGGCGTCGCTGGGTGGC
AATGGATTCCTCGCCTTTCTCCTCAACATTGCGTCCTTCCAAACCAACAAGCTGGCTGGTGCCCTGACGATGACG
GTGTGCGGCAACCTGAAGCAATGCCTGACGGTCCTGATTGGAATCTTCATGTTCAGGATTTCCGTCGACATGCTC
AATGGAGCGGGCATGGGCGTCACCATGATTGGTGCCGCCATCTACAGCAAGGCAGAGTTGGACAACAGGAGGAAA
AGCCGGCAACCGGCTTACCAGGCCCTGGAGCAGAAGCCCAGGTAG
Gene >Ophun1|5343
ATGGCTCGCCTGAGCGGCGACGAGCCCGTGGCCCTTCTCAGGTCCGAGGAGCAAGACGCCGAGTTCAAGGCAGAA
GTCCGCGACGTCGAGAGCGATGCCGGTTCCGATCCTCTTCCCACCCAAAACCTCGATCACGAGTACTCCATACCC
AGCACCGTCAAGTTCACATGGCTCGGCACCTACTTCTTCTTTTCCCTGCTCCTCACCCTCTATAACAAGCTCGTA
CTGGGCATGGTCAGTCTTCTTCCCCGTCCATTAGCAGCGGCAAAGCTGACACGCGCTCGCAGTTCTCCTTTCCTT
GGCTTCTCACCTGCCTCCACGCCTCGTTCGCAAGCTTGGGAACCTACGCCATGATGCACCTGGGCTACTTTAAGC
TCTCGCGACTGGGACGGCGCGAATACCTGGCCCTCCTCGCCTTCAGCGCCCTCTTCACCGCAAACATCGCCCTCT
CCAACCTTTCGCTGGCCATGGTGTCGGTGCCCTTTTACCAGACGATGCGCATGTTGTGCCCCATCTTCACCATTC
TCATCTACCGCGTCTGGTACAGCCGCACCTACAGCGGCATGACGTATCTGTCCCTGGTTCCCCTCATCGTCGGCG
CTGCCATGACGACGGCTGGCGAGATGACGTTTACCGATGCCGGCTTCCTCCTCACCATACTCGGCGTTGTCCTCG
CCGCGGTCAAGGTATGTCGGATCGCTTGTCCATCTAAATGCACCTCCTAACCCGTCGGCAGACCGTCGTCACGAA
CCGATTCATGACGGGCTCGCTGGCCCTACCTCCGATCGAATTTCTGATGCGCATGTCGCCACTGGCAGCTCTGCA
GGCACTGGCATGCGCCACCGTGACGGGCGAGGTGGCTGGCTTCCGCGACCTCATTACATCTGGAAACATCGCCCT
CGGCCCCGCTCTGGCGTCGCTGGGTGGCAATGGATTCCTCGCCTTTCTCCTCAACATTGCGTCCTTCCAAACCAA
CAAGCTGGCTGGTGCCCTGACGATGACGGTGTGCGGCAACCTGAAGCAATGCCTGACGGTCCTGATTGGAATCTT
CATGTTCAGGATTTCCGTCGACATGCTCAATGGAGCGGGCATGGGCGTCACCATGATTGGTGCCGCCATCTACAG
CAAGGCAGAGTTGGACAACAGGAGGAAAAGCCGGCAACCGGCTTACCAGGCCCTGGAGCAGAAGCCCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail