Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5340
Gene name
LocationContig_520:3584..5000
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.8E-09 79 231
PF12146 Hydrolase_4 Serine aminopeptidase, S33 7.3E-08 99 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas sobria GN=pip PE=1 SV=3 9 469 2.0E-86

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3913
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6082
Ophiocordyceps australis map64 (Brazil) OphauB2|7664
Ophiocordyceps camponoti-floridani Ophcf2|00407
Ophiocordyceps camponoti-rufipedis Ophun1|5340 (this protein)
Ophiocordyceps kimflemingae Ophio5|6351
Ophiocordyceps subramaniannii Hirsu2|7793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5340
MEIPPANLLSSTSHAVPGQLLVTELFFQVPLDYADESAGTIILFARRATKRERPVFPPDPSSSSDDDDEKDAPSP
KPYMVYLEGGPGFGNREPQDHPLTRAAIARGYQMLYIDHRGVGLSTPVSAAMLARLGSADAQARYLRLMRQDNTV
RDCEAVRLCLTQGWSAAKAPWSIFGQSYGGFVALSYLSMYPSGLREVFLTGGLAPVGQPIERVYEATFARTAHRN
RQYFAKFPEDTQALRRIADFIREQGGAVPLPAGGILTLPRLMTLGIAFGGHGGFDGVHSILLHLVTSLDQFGFFT
RASLQPLETFTSFDTNIIYAILHEAIYCDGPGKASDWAAYRVGKTLEPFAWLNPDRDDVETWYFAGEMIFPFHFE
TYPELISLRSVAEKLAAVTDWPRLYDEQQLRKNTVPVYAMSYIDDMYVDNDLARETAKLVKGTKVAETNLMYHSA
LRAKSEEVLQALFSLRDDVLD*
Coding >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA
Transcript >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA
Gene >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail