Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5340
Gene name
LocationContig_520:3584..5000
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.8E-09 79 231
PF12146 Hydrolase_4 Serine aminopeptidase, S33 7.3E-08 99 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas sobria GN=pip PE=1 SV=3 9 469 2.0E-86

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5340
MEIPPANLLSSTSHAVPGQLLVTELFFQVPLDYADESAGTIILFARRATKRERPVFPPDPSSSSDDDDEKDAPSP
KPYMVYLEGGPGFGNREPQDHPLTRAAIARGYQMLYIDHRGVGLSTPVSAAMLARLGSADAQARYLRLMRQDNTV
RDCEAVRLCLTQGWSAAKAPWSIFGQSYGGFVALSYLSMYPSGLREVFLTGGLAPVGQPIERVYEATFARTAHRN
RQYFAKFPEDTQALRRIADFIREQGGAVPLPAGGILTLPRLMTLGIAFGGHGGFDGVHSILLHLVTSLDQFGFFT
RASLQPLETFTSFDTNIIYAILHEAIYCDGPGKASDWAAYRVGKTLEPFAWLNPDRDDVETWYFAGEMIFPFHFE
TYPELISLRSVAEKLAAVTDWPRLYDEQQLRKNTVPVYAMSYIDDMYVDNDLARETAKLVKGTKVAETNLMYHSA
LRAKSEEVLQALFSLRDDVLD*
Coding >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA
Transcript >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA
Gene >Ophun1|5340
ATGGAGATCCCCCCGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGTCAGCTGCTCGTCACCGAGCTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATCCTCTTCGCTCGCCGCGCCACCAAG
CGCGAACGCCCCGTCTTCCCCCCCGATCCGTCCTCGTCCTCGGATGACGACGATGAGAAGGATGCGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGGCCGGGCTTCGGCAATCGTGAACCCCAGGATCATCCACTTACTCGC
GCCGCCATTGCCCGTGGCTACCAGATGCTCTACATCGATCATCGCGGCGTCGGCCTCAGCACCCCCGTCTCGGCT
GCTATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAGGCTCGCTACCTGCGTCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCTCTGCCTGACGCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGTTTCGTCGCCCTGTCCTACCTATCCATGTATCCTAGTGGTCTTCGCGAGGTCTTTCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCCATTGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGCGTTGCGTCGCATTGCCGACTTTATCCGCGAACAAGGA
GGAGCCGTACCTCTTCCGGCCGGTGGCATTTTGACGCTGCCCCGTCTGATGACACTCGGAATCGCATTTGGCGGC
CATGGAGGCTTCGACGGAGTTCATTCTATACTTCTTCATCTCGTGACCTCCCTCGACCAGTTTGGCTTCTTCACA
CGCGCCTCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGACACCAACATCATCTATGCCATCCTGCACGAAGCC
ATCTACTGCGACGGTCCTGGCAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAACCCTCGAACCCTTTGCC
TGGCTCAACCCCGACCGTGACGACGTCGAAACCTGGTACTTTGCCGGCGAGATGATATTTCCCTTCCACTTCGAG
ACGTACCCGGAGCTCATATCTTTGCGCTCCGTTGCGGAGAAGCTGGCCGCCGTCACCGACTGGCCACGCCTGTAC
GACGAGCAGCAGCTCCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTACATTGACGACATGTACGTCGACAAC
GATCTCGCCAGGGAGACGGCAAAGCTTGTCAAGGGGACAAAGGTGGCGGAGACGAATCTCATGTACCACTCTGCT
CTGCGGGCCAAGTCGGAGGAGGTCTTACAGGCCCTCTTCAGCTTGAGGGATGATGTCCTAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail