Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5338
Gene name
LocationContig_520:55..1160
Strand+
Gene length (bp)1105
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7EFY0|TVP38_SCLS1 Golgi apparatus membrane protein tvp38 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp38 PE=3 SV=1 13 117 3.0E-17
sp|A1CIM4|TVP38_ASPCL Golgi apparatus membrane protein tvp38 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp38 PE=3 SV=1 17 118 6.0E-17
sp|Q5B7A1|TVP38_EMENI Golgi apparatus membrane protein tvp38 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tvp38 PE=3 SV=1 17 191 1.0E-16
sp|Q0CT01|TVP38_ASPTN Golgi apparatus membrane protein tvp38 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp38 PE=3 SV=1 39 117 7.0E-16
sp|A6RIB9|TVP38_BOTFB Golgi apparatus membrane protein tvp38 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp38 PE=3 SV=1 13 117 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7EFY0|TVP38_SCLS1 Golgi apparatus membrane protein tvp38 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp38 PE=3 SV=1 13 117 3.0E-17
sp|A1CIM4|TVP38_ASPCL Golgi apparatus membrane protein tvp38 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp38 PE=3 SV=1 17 118 6.0E-17
sp|Q5B7A1|TVP38_EMENI Golgi apparatus membrane protein tvp38 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tvp38 PE=3 SV=1 17 191 1.0E-16
sp|Q0CT01|TVP38_ASPTN Golgi apparatus membrane protein tvp38 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp38 PE=3 SV=1 39 117 7.0E-16
sp|A6RIB9|TVP38_BOTFB Golgi apparatus membrane protein tvp38 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp38 PE=3 SV=1 13 117 7.0E-16
sp|A1CW44|TVP38_NEOFI Golgi apparatus membrane protein tvp38 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tvp38 PE=3 SV=1 39 118 3.0E-15
sp|Q4WQJ2|TVP38_ASPFU Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp38 PE=3 SV=1 39 118 5.0E-15
sp|B0Y4Q5|TVP38_ASPFC Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tvp38 PE=3 SV=1 39 118 5.0E-15
sp|A2Q9P2|TVP38_ASPNC Golgi apparatus membrane protein tvp38 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tvp38 PE=3 SV=2 39 117 8.0E-15
sp|Q2UUJ9|TVP38_ASPOR Golgi apparatus membrane protein tvp38 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tvp38 PE=3 SV=2 39 118 2.0E-14
sp|Q2UUJ9|TVP38_ASPOR Golgi apparatus membrane protein tvp38 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tvp38 PE=3 SV=2 113 225 3.0E-13
sp|A5DH87|TVP38_PICGU Golgi apparatus membrane protein TVP38 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TVP38 PE=3 SV=2 3 113 2.0E-12
sp|A7EFY0|TVP38_SCLS1 Golgi apparatus membrane protein tvp38 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp38 PE=3 SV=1 113 236 3.0E-12
sp|A2Q9P2|TVP38_ASPNC Golgi apparatus membrane protein tvp38 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tvp38 PE=3 SV=2 119 246 4.0E-11
sp|A1CW44|TVP38_NEOFI Golgi apparatus membrane protein tvp38 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tvp38 PE=3 SV=1 119 189 1.0E-10
sp|B0Y4Q5|TVP38_ASPFC Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tvp38 PE=3 SV=1 119 186 3.0E-10
sp|Q4WQJ2|TVP38_ASPFU Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp38 PE=3 SV=1 119 186 3.0E-10
sp|A1CIM4|TVP38_ASPCL Golgi apparatus membrane protein tvp38 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp38 PE=3 SV=1 113 186 2.0E-09
sp|Q6BQJ1|TVP38_DEBHA Golgi apparatus membrane protein TVP38 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TVP38 PE=3 SV=1 3 113 2.0E-09
sp|A8NX72|TVP38_COPC7 Golgi apparatus membrane protein TVP38 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TVP38 PE=3 SV=1 84 214 2.0E-08
sp|Q0CT01|TVP38_ASPTN Golgi apparatus membrane protein tvp38 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp38 PE=3 SV=1 113 206 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 54 76 22
3 83 105 22
4 148 170 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5338
MPDRERSRPTRRLTLCILALVVLVGLAIAAAYLSHHFFFTWLAPLARTYKGHPLALTLVFLAIFISAFPPLVGYS
TAATVAGFVAGFPGGWPLAATAAVAGSLAAFAASRSVLGRCVESPKLLVHVFIGSRLALLADEGDTMSTSDKAIN
YLSMAASALIGLIVGLMVYRRTMARAAQLAREDIHHHHPRRHLASSAADAEAGYHDVDAPLLDPDDAAAVMLDDN
LSSWTVDGGEEEEDHGRSKAAMSGGGNGHSHLGFSA*
Coding >Ophun1|5338
ATGCCAGACCGGGAGAGAAGCCGTCCGACCCGGAGACTCACCCTCTGCATCCTCGCCCTCGTCGTCCTCGTCGGC
CTCGCCATAGCAGCCGCCTACCTCTCCCACCACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTACAAG
GGCCACCCGCTGGCGCTGACGCTCGTCTTCCTCGCCATCTTCATCTCCGCCTTCCCGCCGCTGGTCGGGTACTCG
ACGGCCGCCACCGTCGCCGGCTTCGTCGCCGGCTTTCCGGGCGGGTGGCCTCTTGCTGCGACGGCGGCGGTGGCG
GGCAGTCTGGCGGCGTTTGCGGCCAGTCGGTCGGTGCTGGGGAGGTGTGTTGAGAGCCCCAAGCTTCTAGTCCAC
GTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCACCTCGGACAAGGCAATCAAC
TACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGATAGTCGGGCTGATGGTCTACCGCCGCACCATGGCTCGA
GCCGCGCAACTCGCTCGCGAAGACATTCATCATCACCACCCGCGTCGTCATCTTGCTTCTTCGGCTGCTGATGCT
GAGGCGGGATATCACGATGTGGATGCTCCGCTTCTTGATCCGGATGATGCGGCTGCTGTGATGCTGGATGATAAT
CTGTCGTCTTGGACGGTTGATGGGGGGGAAGAGGAGGAGGATCATGGTCGTTCCAAGGCGGCCATGTCCGGGGGG
GGCAATGGGCATTCGCATCTTGGGTTTTCCGCCTGA
Transcript >Ophun1|5338
ATGCCAGACCGGGAGAGAAGCCGTCCGACCCGGAGACTCACCCTCTGCATCCTCGCCCTCGTCGTCCTCGTCGGC
CTCGCCATAGCAGCCGCCTACCTCTCCCACCACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTACAAG
GGCCACCCGCTGGCGCTGACGCTCGTCTTCCTCGCCATCTTCATCTCCGCCTTCCCGCCGCTGGTCGGGTACTCG
ACGGCCGCCACCGTCGCCGGCTTCGTCGCCGGCTTTCCGGGCGGGTGGCCTCTTGCTGCGACGGCGGCGGTGGCG
GGCAGTCTGGCGGCGTTTGCGGCCAGTCGGTCGGTGCTGGGGAGGTGTGTTGAGAGCCCCAAGCTTCTAGTCCAC
GTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCACCTCGGACAAGGCAATCAAC
TACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGATAGTCGGGCTGATGGTCTACCGCCGCACCATGGCTCGA
GCCGCGCAACTCGCTCGCGAAGACATTCATCATCACCACCCGCGTCGTCATCTTGCTTCTTCGGCTGCTGATGCT
GAGGCGGGATATCACGATGTGGATGCTCCGCTTCTTGATCCGGATGATGCGGCTGCTGTGATGCTGGATGATAAT
CTGTCGTCTTGGACGGTTGATGGGGGGGAAGAGGAGGAGGATCATGGTCGTTCCAAGGCGGCCATGTCCGGGGGG
GGCAATGGGCATTCGCATCTTGGGTTTTCCGCCTGA
Gene >Ophun1|5338
ATGCCAGACCGGGAGAGAAGCCGTCCGACCCGGAGGTCCTCCTCCTCCTCCGCCCCCCCAACCCTAACAGCCACG
CTCCTATCCCGCCTCCAATCCCTCACCTTCGGCCAAAGACTCACCCTCTGCATCCTCGCCCTCGTCGTCCTCGTC
GGCCTCGCCATAGCAGCCGCCTACCTCTCCCACCACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTAC
AAGGGCCACCCGCTGGCGCTGACGCTCGTCTTCCTCGCCATCTTCATCTCCGCCTTCCCGCCGCTGGTCGGGTAC
TCGACGGCCGCCACCGTCGCCGGCTTCGTCGCCGGCTTTCCGGGCGGGTGGCCTCTTGCTGCGACGGCGGCGGTG
GCGGGCAGTCTGGCGGCGTTTGCGGCCAGTCGGTCGGTGCTGGGGAGGTGTGTTGAGAGGTGGGTTGGCAAGGAT
AGGCGGTTTGTGGCTTTGGCGCAGGTTTTGAGGAGGGATGGGTTGGTTTGCTTGGCGGGCATTCGGCTTTGTCCT
TTGCCGTTTAGTTTGAGTAATGGGTTTTTGGCCACGGTGCCCAGTGTTTCTCCCTGGGCTTTTGCTGTTGCTACT
GCTATATCCAGGTCTGTTCCCCCCTTTCCTCCCTCTTCTTCACACCCTCTTACTGACAGACTGACTCTGCAAAAG
CCCCAAGCTTCTAGTCCACGTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCAC
CTCGGACAAGGCAATCAACTACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGATAGTCGGGCTGATGGTCTA
CCGCCGCACCATGGCTCGAGCCGCGCAACTCGCTCGCGAAGACATTCATCATCACCACCCGCGTCGTCATCTTGC
TTCTTCGGCTGCTGATGCTGAGGCGGGATATCACGATGTGGATGCTCCGCTTCTTGATCCGGATGATGCGGCTGC
TGTGATGCTGGATGATAATCTGTCGTCTTGGACGGTTGATGGGGGGGAAGAGGAGGAGGATCATGGTCGTTCCAA
GGCGGCCATGTCCGGGGGGGGCAATGGGCATTCGCATCTTGGGTTTTCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail