Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|532
Gene name
LocationContig_116:24875..25683
Strand-
Gene length (bp)808
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.4E-04 114 150
PF01476 LysM LysM domain 4.8E-02 206 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 35 249 2.0E-22
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 35 250 1.0E-20
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 110 248 2.0E-13
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 110 247 5.0E-11
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 39 158 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 35 249 2.0E-22
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 35 250 1.0E-20
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 110 248 2.0E-13
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 110 247 5.0E-11
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 39 158 1.0E-08
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 39 159 3.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999745

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6463
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03065
Ophiocordyceps camponoti-rufipedis Ophun1|532 (this protein)
Ophiocordyceps kimflemingae Ophio5|1359
Ophiocordyceps kimflemingae Ophio5|3
Ophiocordyceps kimflemingae Ophio5|5951

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|532
MKAWLSFLVVVWASLAAASPYARYSGDFVTKRQPVRDRCGAYATASDGETCSSLEEKWGLVREDFLRLNPSIKGE
CTLTVKHDYCIARPIIASRAVSPPPSLPAGSGTNCGSFYRAVSGDTCNSIASSQPKLTVEDFIRWNPTVGADCRH
LLPEAFYCISQFEDLESKQTAPTTSVNISISQKPSPRPQPIQDGIADGCLSFYRAIPGDSCQVVADKHGISLANF
LALNPVVGGSTCDRMLAGYHYCVSTTSA*
Coding >Ophun1|532
ATGAAAGCCTGGCTGTCGTTCTTGGTCGTCGTCTGGGCCTCTCTGGCCGCGGCCTCCCCCTACGCCCGGTACAGC
GGCGACTTCGTTACCAAGCGGCAGCCTGTCCGCGACCGATGCGGTGCCTACGCTACTGCCTCTGATGGAGAGACG
TGCAGTTCCCTCGAGGAGAAATGGGGGCTCGTTCGCGAGGATTTTCTTAGATTGAACCCATCCATCAAAGGCGAA
TGTACCCTCACCGTCAAGCACGACTACTGCATCGCCCGTCCCATCATCGCCTCCCGCGCAGTGTCCCCCCCTCCA
TCTCTACCAGCCGGCTCCGGCACCAACTGCGGCTCCTTCTACCGCGCCGTCTCGGGAGATACCTGCAACAGCATC
GCCAGTTCCCAACCCAAGCTCACGGTCGAAGACTTCATCCGGTGGAACCCTACCGTCGGAGCGGATTGTCGACAC
CTACTACCCGAAGCATTCTACTGCATCTCGCAGTTTGAGGATCTCGAGTCAAAGCAGACGGCACCCACGACAAGC
GTCAACATTTCCATCTCCCAGAAACCCTCGCCCAGACCGCAGCCAATCCAGGACGGTATCGCAGACGGTTGTCTC
TCCTTTTACCGCGCCATCCCAGGCGATAGCTGCCAAGTCGTCGCAGACAAGCACGGCATCAGCCTCGCAAACTTC
CTCGCCCTGAATCCCGTCGTAGGCGGTTCCACCTGCGATCGCATGCTAGCTGGCTATCACTACTGCGTCTCGACA
ACCAGTGCGTAA
Transcript >Ophun1|532
ATGAAAGCCTGGCTGTCGTTCTTGGTCGTCGTCTGGGCCTCTCTGGCCGCGGCCTCCCCCTACGCCCGGTACAGC
GGCGACTTCGTTACCAAGCGGCAGCCTGTCCGCGACCGATGCGGTGCCTACGCTACTGCCTCTGATGGAGAGACG
TGCAGTTCCCTCGAGGAGAAATGGGGGCTCGTTCGCGAGGATTTTCTTAGATTGAACCCATCCATCAAAGGCGAA
TGTACCCTCACCGTCAAGCACGACTACTGCATCGCCCGTCCCATCATCGCCTCCCGCGCAGTGTCCCCCCCTCCA
TCTCTACCAGCCGGCTCCGGCACCAACTGCGGCTCCTTCTACCGCGCCGTCTCGGGAGATACCTGCAACAGCATC
GCCAGTTCCCAACCCAAGCTCACGGTCGAAGACTTCATCCGGTGGAACCCTACCGTCGGAGCGGATTGTCGACAC
CTACTACCCGAAGCATTCTACTGCATCTCGCAGTTTGAGGATCTCGAGTCAAAGCAGACGGCACCCACGACAAGC
GTCAACATTTCCATCTCCCAGAAACCCTCGCCCAGACCGCAGCCAATCCAGGACGGTATCGCAGACGGTTGTCTC
TCCTTTTACCGCGCCATCCCAGGCGATAGCTGCCAAGTCGTCGCAGACAAGCACGGCATCAGCCTCGCAAACTTC
CTCGCCCTGAATCCCGTCGTAGGCGGTTCCACCTGCGATCGCATGCTAGCTGGCTATCACTACTGCGTCTCGACA
ACCAGTGCGTAA
Gene >Ophun1|532
ATGAAAGCCTGGCTGTCGTTCTTGGTCGTCGTCTGGGCCTCTCTGGCCGCGGCCTCCCCCTACGCCCGGTACAGC
GGCGACTTCGTTACCAAGCGGCAGCCTGTCCGCGACCGATGCGGTGCCTACGCTACTGCCTCTGATGGAGAGACG
TGCAGTTCCCTCGAGGAGAAATGGGGGCTCGTTCGCGAGGATTTTCTTAGATTGGTGAGGCCATCGTCACCAGTC
CCAGGCTTGAAGCTTACAGACGCAGAACCCATCCATCAAAGGCGAATGTACCCTCACCGTCAAGCACGACTACTG
CATCGCCCGTCCCATCATCGCCTCCCGCGCAGTGTCCCCCCCTCCATCTCTACCAGCCGGCTCCGGCACCAACTG
CGGCTCCTTCTACCGCGCCGTCTCGGGAGATACCTGCAACAGCATCGCCAGTTCCCAACCCAAGCTCACGGTCGA
AGACTTCATCCGGTGGAACCCTACCGTCGGAGCGGATTGTCGACACCTACTACCCGAAGCATTCTACTGCATCTC
GCAGTTTGAGGATCTCGAGTCAAAGCAGACGGCACCCACGACAAGCGTCAACATTTCCATCTCCCAGAAACCCTC
GCCCAGACCGCAGCCAATCCAGGACGGTATCGCAGACGGTTGTCTCTCCTTTTACCGCGCCATCCCAGGCGATAG
CTGCCAAGTCGTCGCAGACAAGCACGGCATCAGCCTCGCAAACTTCCTCGCCCTGAATCCCGTCGTAGGCGGTTC
CACCTGCGATCGCATGCTAGCTGGCTATCACTACTGCGTCTCGACAACCAGTGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail