Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5319
Gene name
LocationContig_52:1545..3131
Strand+
Gene length (bp)1586
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06423 GWT1 GWT1 4.1E-41 296 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SCL1|GWT1_NEUCR GPI-anchored wall transfer protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gwt1 PE=3 SV=1 4 478 0.0E+00
sp|Q2HCW8|GWT1_CHAGB GPI-anchored wall transfer protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GWT1 PE=3 SV=1 7 478 0.0E+00
sp|Q4IQ08|GWT1_GIBZE GPI-anchored wall transfer protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GWT1 PE=3 SV=1 1 478 0.0E+00
sp|Q5BF53|GWT1_EMENI GPI-anchored wall transfer protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gwt1 PE=3 SV=1 7 478 4.0E-161
sp|Q873N1|GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gwt1 PE=3 SV=2 7 476 2.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SCL1|GWT1_NEUCR GPI-anchored wall transfer protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gwt1 PE=3 SV=1 4 478 0.0E+00
sp|Q2HCW8|GWT1_CHAGB GPI-anchored wall transfer protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GWT1 PE=3 SV=1 7 478 0.0E+00
sp|Q4IQ08|GWT1_GIBZE GPI-anchored wall transfer protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GWT1 PE=3 SV=1 1 478 0.0E+00
sp|Q5BF53|GWT1_EMENI GPI-anchored wall transfer protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gwt1 PE=3 SV=1 7 478 4.0E-161
sp|Q873N1|GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gwt1 PE=3 SV=2 7 476 2.0E-157
sp|Q2UQH4|GWT1_ASPOR GPI-anchored wall transfer protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gwt1 PE=3 SV=1 5 478 1.0E-156
sp|Q6CAW6|GWT1_YARLI GPI-anchored wall transfer protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GWT1 PE=3 SV=1 8 478 2.0E-105
sp|Q873N2|GWT1_CANAL GPI-anchored wall transfer protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GWT1 PE=3 SV=1 4 478 1.0E-102
sp|Q754I2|GWT1_ASHGO GPI-anchored wall transfer protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GWT1 PE=3 SV=1 8 478 1.0E-99
sp|P47026|GWT1_YEAST GPI-anchored wall transfer protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GWT1 PE=1 SV=2 8 478 5.0E-91
sp|Q6FLH2|GWT1_CANGA GPI-anchored wall transfer protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GWT1 PE=3 SV=1 8 478 6.0E-91
sp|Q6BTT3|GWT1_DEBHA GPI-anchored wall transfer protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GWT1 PE=3 SV=2 8 478 1.0E-90
sp|Q9UTL4|GWT1_SCHPO GPI-anchored wall transfer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gwt1 PE=1 SV=1 7 478 2.0E-71
sp|Q6CK18|GWT1_KLULA GPI-anchored wall transfer protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GWT1 PE=3 SV=1 8 458 1.0E-68
sp|P0CP64|GWT1_CRYNJ GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GWT1 PE=3 SV=1 95 476 8.0E-60
sp|P0CP65|GWT1_CRYNB GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GWT1 PE=3 SV=1 95 476 8.0E-60
sp|Q54MC0|PIGW_DICDI Phosphatidylinositol-glycan biosynthesis class W protein OS=Dictyostelium discoideum GN=pigw PE=3 SV=2 122 478 2.0E-59
sp|Q873N0|GWT1_CRYNH GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=GWT1 PE=3 SV=1 123 476 8.0E-59
sp|B3H6K1|Y4791_ARATH Uncharacterized protein At4g17910 OS=Arabidopsis thaliana GN=At4g17910 PE=2 SV=2 111 465 1.0E-58
sp|Q7TSN4|PIGW_RAT Phosphatidylinositol-glycan biosynthesis class W protein OS=Rattus norvegicus GN=Pigw PE=1 SV=1 8 478 3.0E-55
sp|Q8C398|PIGW_MOUSE Phosphatidylinositol-glycan biosynthesis class W protein OS=Mus musculus GN=Pigw PE=2 SV=1 8 478 2.0E-52
sp|Q1LZA4|PIGW_BOVIN Phosphatidylinositol-glycan biosynthesis class W protein OS=Bos taurus GN=PIGW PE=2 SV=1 8 447 2.0E-48
sp|Q7Z7B1|PIGW_HUMAN Phosphatidylinositol-glycan biosynthesis class W protein OS=Homo sapiens GN=PIGW PE=1 SV=1 8 458 7.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0006497 protein lipidation No
GO:0006505 GPI anchor metabolic process No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006643 membrane lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0008150 biological_process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0006664 glycolipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 66 88 22
3 125 147 22
4 162 184 22
5 233 255 22
6 265 287 22
7 300 322 22
8 370 392 22
9 422 444 22
10 454 476 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5319
MADAARYKQRKEAFVSNLSGGSVAEVAVLLWSVLQTRQALFRSHTTLGLALDYAINVGAILLATTVYASSSVLLD
LLLLAPAALVYALPPSSGKKKKPRVPPPATDGTVEPGPARLEGLPVKPFLTMYRGCMMVVTCVAILAVDFRLFPR
RFAKVETWGTSLMDMGVGSFVFAGGVVAARPVLSERMAGRTRSLLRRLAYSARHSVPLLVLGGVRLASVKGLDYA
EHVTEYGVHWNFFFTLGFLAPLVAICHSALRIVPSYAGLALLVAGTYEVLLDKTALSAYILGAPRTDLISMNREG
IFSFFGYLAIFLAGLDTGMAVIPRHATGRPPLRSTALRGLAWSGLYWLCTDYSYGFGLSVSRRLANLPYVAWVAA
FNSLQLLAFCGIDAVFFPHFYKAVDAKAEKEAHRTATSRVLRAYNRNGLAIFLVANLLTGVVNMTVRTLDAGPVM
TMGVLLAYTAAVTGLAVGLDAYNVSIKL*
Coding >Ophun1|5319
ATGGCCGACGCAGCCAGATACAAGCAACGCAAGGAAGCCTTTGTCTCCAACCTCTCTGGCGGCTCCGTCGCCGAG
GTCGCCGTTCTGCTGTGGTCCGTTCTCCAGACACGTCAGGCCTTGTTCCGATCTCACACGACACTCGGTCTCGCC
CTCGACTATGCGATCAATGTCGGCGCCATACTGTTGGCCACGACGGTCTACGCCAGCTCGTCGGTGCTGCTCGAC
CTACTCCTGCTCGCGCCCGCCGCGCTGGTGTACGCGCTCCCGCCTAGCAGCGGCAAGAAGAAGAAGCCTAGGGTC
CCGCCACCGGCTACCGACGGCACGGTGGAGCCCGGGCCGGCGCGGCTCGAGGGCCTCCCCGTGAAGCCTTTCCTG
ACGATGTATCGCGGCTGCATGATGGTGGTGACATGTGTCGCCATCCTGGCCGTCGACTTCCGTCTCTTTCCGCGC
CGCTTTGCCAAGGTCGAGACGTGGGGCACGTCGCTCATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGGGGC
GTCGTCGCTGCGAGACCGGTTCTTTCCGAGCGCATGGCGGGCCGAACAAGGTCGCTGCTCCGCCGACTCGCCTAC
TCGGCCCGGCACTCGGTTCCGCTACTGGTACTGGGCGGCGTGCGGCTCGCCAGTGTCAAGGGCCTCGACTACGCT
GAGCACGTCACCGAGTACGGGGTGCACTGGAACTTCTTCTTCACGCTTGGCTTCCTCGCGCCCTTGGTAGCTATC
TGCCACTCGGCGCTGCGCATCGTGCCGTCGTACGCGGGCCTGGCGCTGCTCGTCGCCGGCACGTACGAGGTCCTT
CTCGATAAGACGGCGCTGTCGGCCTACATCCTCGGCGCTCCCAGAACGGATCTTATTTCGATGAACAGGGAGGGC
ATCTTTAGCTTCTTCGGCTATCTCGCCATCTTCCTCGCCGGCCTGGACACGGGCATGGCCGTCATCCCTCGGCAC
GCGACCGGGCGGCCGCCGCTCAGGTCGACGGCGCTCCGTGGCTTGGCTTGGTCTGGGCTGTACTGGCTGTGTACC
GACTACTCGTACGGGTTCGGGCTCAGTGTGTCGCGACGGCTGGCCAACCTGCCTTATGTGGCCTGGGTGGCGGCC
TTTAACTCACTGCAGCTGCTGGCCTTTTGCGGCATCGACGCCGTCTTCTTTCCGCACTTTTACAAGGCCGTCGAT
GCCAAGGCCGAGAAAGAGGCCCACAGAACGGCCACGAGTCGCGTGCTGCGGGCATATAACCGCAACGGGCTCGCC
ATCTTCCTCGTGGCCAACCTTCTGACGGGGGTGGTCAACATGACGGTCCGCACGCTCGACGCCGGCCCGGTCATG
ACGATGGGGGTGCTGCTTGCGTATACGGCGGCGGTGACTGGACTGGCCGTGGGGCTTGATGCGTACAACGTGTCC
ATCAAGCTGTGA
Transcript >Ophun1|5319
ATGGCCGACGCAGCCAGATACAAGCAACGCAAGGAAGCCTTTGTCTCCAACCTCTCTGGCGGCTCCGTCGCCGAG
GTCGCCGTTCTGCTGTGGTCCGTTCTCCAGACACGTCAGGCCTTGTTCCGATCTCACACGACACTCGGTCTCGCC
CTCGACTATGCGATCAATGTCGGCGCCATACTGTTGGCCACGACGGTCTACGCCAGCTCGTCGGTGCTGCTCGAC
CTACTCCTGCTCGCGCCCGCCGCGCTGGTGTACGCGCTCCCGCCTAGCAGCGGCAAGAAGAAGAAGCCTAGGGTC
CCGCCACCGGCTACCGACGGCACGGTGGAGCCCGGGCCGGCGCGGCTCGAGGGCCTCCCCGTGAAGCCTTTCCTG
ACGATGTATCGCGGCTGCATGATGGTGGTGACATGTGTCGCCATCCTGGCCGTCGACTTCCGTCTCTTTCCGCGC
CGCTTTGCCAAGGTCGAGACGTGGGGCACGTCGCTCATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGGGGC
GTCGTCGCTGCGAGACCGGTTCTTTCCGAGCGCATGGCGGGCCGAACAAGGTCGCTGCTCCGCCGACTCGCCTAC
TCGGCCCGGCACTCGGTTCCGCTACTGGTACTGGGCGGCGTGCGGCTCGCCAGTGTCAAGGGCCTCGACTACGCT
GAGCACGTCACCGAGTACGGGGTGCACTGGAACTTCTTCTTCACGCTTGGCTTCCTCGCGCCCTTGGTAGCTATC
TGCCACTCGGCGCTGCGCATCGTGCCGTCGTACGCGGGCCTGGCGCTGCTCGTCGCCGGCACGTACGAGGTCCTT
CTCGATAAGACGGCGCTGTCGGCCTACATCCTCGGCGCTCCCAGAACGGATCTTATTTCGATGAACAGGGAGGGC
ATCTTTAGCTTCTTCGGCTATCTCGCCATCTTCCTCGCCGGCCTGGACACGGGCATGGCCGTCATCCCTCGGCAC
GCGACCGGGCGGCCGCCGCTCAGGTCGACGGCGCTCCGTGGCTTGGCTTGGTCTGGGCTGTACTGGCTGTGTACC
GACTACTCGTACGGGTTCGGGCTCAGTGTGTCGCGACGGCTGGCCAACCTGCCTTATGTGGCCTGGGTGGCGGCC
TTTAACTCACTGCAGCTGCTGGCCTTTTGCGGCATCGACGCCGTCTTCTTTCCGCACTTTTACAAGGCCGTCGAT
GCCAAGGCCGAGAAAGAGGCCCACAGAACGGCCACGAGTCGCGTGCTGCGGGCATATAACCGCAACGGGCTCGCC
ATCTTCCTCGTGGCCAACCTTCTGACGGGGGTGGTCAACATGACGGTCCGCACGCTCGACGCCGGCCCGGTCATG
ACGATGGGGGTGCTGCTTGCGTATACGGCGGCGGTGACTGGACTGGCCGTGGGGCTTGATGCGTACAACGTGTCC
ATCAAGCTGTGA
Gene >Ophun1|5319
ATGGCCGACGCAGCCAGATACAAGCAACGCAAGGAAGCCTTTGTCTCCAACCTCTCTGGCGGCTCCGTCGCCGAG
GTTGGCCTCGTGACGTCCGTGGCGCCGGCAAGTGGCCTTGGTCTCTTCCCACCCGCACGGGCGCACACGCCACTC
TTCTTCGACTTGCCGACTCTCTTCGGCAGCAGCTGACGTCGTTTTGAACAATCTGACGCTCCCCTTGTCTCCAGG
TCGCCGTTCTGCTGTGGTCCGTTCTCCAGACACGTCAGGCCTTGTTCCGATCTCACACGACACTCGGTCTCGCCC
TCGACTATGCGATCAATGTCGGCGCCATACTGTTGGCCACGACGGTCTACGCCAGCTCGTCGGTGCTGCTCGACC
TACTCCTGCTCGCGCCCGCCGCGCTGGTGTACGCGCTCCCGCCTAGCAGCGGCAAGAAGAAGAAGCCTAGGGTCC
CGCCACCGGCTACCGACGGCACGGTGGAGCCCGGGCCGGCGCGGCTCGAGGGCCTCCCCGTGAAGCCTTTCCTGA
CGATGTATCGCGGCTGCATGATGGTGGTGACATGTGTCGCCATCCTGGCCGTCGACTTCCGTCTCTTTCCGCGCC
GCTTTGCCAAGGTCGAGACGTGGGGCACGTCGCTCATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGGGGCG
TCGTCGCTGCGAGACCGGTTCTTTCCGAGCGCATGGCGGGCCGAACAAGGTCGCTGCTCCGCCGACTCGCCTACT
CGGCCCGGCACTCGGTTCCGCTACTGGTACTGGGCGGCGTGCGGCTCGCCAGTGTCAAGGGCCTCGACTACGCTG
AGCACGTCACCGAGTACGGGGTGCACTGGAACTTCTTCTTCACGCTTGGCTTCCTCGCGCCCTTGGTAGCTATCT
GCCACTCGGCGCTGCGCATCGTGCCGTCGTACGCGGGCCTGGCGCTGCTCGTCGCCGGCACGTACGAGGTCCTTC
TCGATAAGACGGCGCTGTCGGCCTACATCCTCGGCGCTCCCAGAACGGATCTTATTTCGATGAACAGGGAGGGCA
TCTTTAGCTTCTTCGGCTATCTCGCCATCTTCCTCGCCGGCCTGGACACGGGCATGGCCGTCATCCCTCGGCACG
CGACCGGGCGGCCGCCGCTCAGGTCGACGGCGCTCCGTGGCTTGGCTTGGTCTGGGCTGTACTGGCTGTGTACCG
ACTACTCGTACGGGTTCGGGCTCAGTGTGTCGCGACGGCTGGCCAACCTGCCTTATGTGGCCTGGGTGGCGGCCT
TTAACTCACTGCAGCTGCTGGCCTTTTGCGGCATCGACGCCGTCTTCTTTCCGCACTTTTACAAGGCCGTCGATG
CCAAGGCCGAGAAAGAGGCCCACAGAACGGCCACGAGTCGCGTGCTGCGGGCATATAACCGCAACGGGCTCGCCA
TCTTCCTCGTGGCCAACCTTCTGACGGGGGTGGTCAACATGACGGTCCGCACGCTCGACGCCGGCCCGGTCATGA
CGATGGGGGTGCTGCTTGCGTATACGGCGGCGGTGACTGGACTGGCCGTGGGGCTTGATGCGTACAACGTGTCCA
TCAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail