Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5315
Gene name
LocationContig_519:7823..8649
Strand-
Gene length (bp)826
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 1.7E-16 77 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RCZ2|CY561_PONAB Cytochrome b561 OS=Pongo abelii GN=CYB561 PE=2 SV=1 44 196 7.0E-08
sp|Q91577|CY561_XENLA Cytochrome b561 OS=Xenopus laevis GN=cyb561 PE=2 SV=1 44 195 8.0E-08
sp|P49447|CY561_HUMAN Cytochrome b561 OS=Homo sapiens GN=CYB561 PE=1 SV=2 38 196 1.0E-07
sp|Q60720|CY561_MOUSE Cytochrome b561 OS=Mus musculus GN=Cyb561 PE=1 SV=2 44 196 1.0E-06
sp|Q95204|CY561_SHEEP Cytochrome b561 OS=Ovis aries GN=CYB561 PE=2 SV=1 44 200 5.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RCZ2|CY561_PONAB Cytochrome b561 OS=Pongo abelii GN=CYB561 PE=2 SV=1 44 196 7.0E-08
sp|Q91577|CY561_XENLA Cytochrome b561 OS=Xenopus laevis GN=cyb561 PE=2 SV=1 44 195 8.0E-08
sp|P49447|CY561_HUMAN Cytochrome b561 OS=Homo sapiens GN=CYB561 PE=1 SV=2 38 196 1.0E-07
sp|Q60720|CY561_MOUSE Cytochrome b561 OS=Mus musculus GN=Cyb561 PE=1 SV=2 44 196 1.0E-06
sp|Q95204|CY561_SHEEP Cytochrome b561 OS=Ovis aries GN=CYB561 PE=2 SV=1 44 200 5.0E-06
sp|P10897|CY561_BOVIN Cytochrome b561 OS=Bos taurus GN=CYB561 PE=1 SV=2 44 200 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 71 93 22
3 114 131 17
4 146 168 22
5 188 207 19
6 212 234 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5315
MASATGMPARAEAGGPEPSDTEPLLGRPGDVIQRRDTSFPQNFVMGTASLAQLGAVLGLILVWASVFNKPLIIFS
AHPLLQSLAVFTLIQSVLSLQPTHTAEQKRLGQRVHASLNLVALLLLIAGVTIIEYNKLSSHGPHFHSVHGYLGV
IVSIVIIVQYLVGFTMWAVPALYGGEVRARSVWKYHRYSGYAVLLLLLVTVCSATETDYNRNVLHMKLWAVVMAS
ILVVVGVFPRIQKYKLGLGTAPPPREAAR*
Coding >Ophun1|5315
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGCGGCCCCGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTCCCTCAAAACTTTGTTATGGGAACGGCCTCGCTC
GCTCAACTCGGCGCCGTCCTCGGCCTGATCCTCGTATGGGCTTCCGTCTTCAATAAGCCGCTGATTATCTTCTCC
GCCCATCCGTTGCTGCAGTCTCTCGCCGTCTTTACACTCATCCAGTCGGTGTTGTCGCTGCAGCCGACGCACACG
GCCGAGCAGAAGCGGCTGGGTCAGCGCGTCCATGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGC
GTCACCATCATCGAGTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTATCTTGGCGTC
ATTGTCAGCATCGTCATCATCGTGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGC
GAGGTTCGTGCCCGCTCCGTCTGGAAATACCACCGCTACTCGGGATATGCGGTTCTCCTGCTGCTGCTCGTGACG
GTGTGCAGCGCCACCGAGACAGACTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCGTAGTCATGGCCTCC
ATCCTCGTCGTTGTCGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGCCTCGGCACTGCGCCTCCTCCGCGC
GAGGCTGCCCGTTAA
Transcript >Ophun1|5315
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGCGGCCCCGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTCCCTCAAAACTTTGTTATGGGAACGGCCTCGCTC
GCTCAACTCGGCGCCGTCCTCGGCCTGATCCTCGTATGGGCTTCCGTCTTCAATAAGCCGCTGATTATCTTCTCC
GCCCATCCGTTGCTGCAGTCTCTCGCCGTCTTTACACTCATCCAGTCGGTGTTGTCGCTGCAGCCGACGCACACG
GCCGAGCAGAAGCGGCTGGGTCAGCGCGTCCATGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGC
GTCACCATCATCGAGTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTATCTTGGCGTC
ATTGTCAGCATCGTCATCATCGTGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGC
GAGGTTCGTGCCCGCTCCGTCTGGAAATACCACCGCTACTCGGGATATGCGGTTCTCCTGCTGCTGCTCGTGACG
GTGTGCAGCGCCACCGAGACAGACTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCGTAGTCATGGCCTCC
ATCCTCGTCGTTGTCGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGCCTCGGCACTGCGCCTCCTCCGCGC
GAGGCTGCCCGTTAA
Gene >Ophun1|5315
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGCGGCCCCGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTCCCTCAAAACTTTGTTATGGGTATGCTGCTGCCT
CGGCTCGCTTCGTCTCGGATGATGCGCTGACCGGACGCTCCGTCAAGGAACGGCCTCGCTCGCTCAACTCGGCGC
CGTCCTCGGCCTGATCCTCGTATGGGCTTCCGTCTTCAATAAGCCGCTGATTATCTTCTCCGCCCATCCGTTGCT
GCAGTCTCTCGCCGTCTTTACACTCATCCAGTCGGTGTTGTCGCTGCAGCCGACGCACACGGCCGAGCAGAAGCG
GCTGGGTCAGCGCGTCCATGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGCGTCACCATCATCGA
GTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTATCTTGGCGTCATTGTCAGCATCGT
CATCATCGTGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGCGAGGTTCGTGCCCG
CTCCGTCTGGAAATACCACCGCTACTCGGGATATGCGGTTCTCCTGCTGCTGCTCGTGACGGTGTGCAGCGCCAC
CGAGACAGACTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCGTAGTCATGGCCTCCATCCTCGTCGTTGT
CGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGCCTCGGCACTGCGCCTCCTCCGCGCGAGGCTGCCCGTTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail