Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5313
Gene name
LocationContig_519:55..5477
Strand-
Gene length (bp)5422
Transcript length (bp)5358
Coding sequence length (bp)5358
Protein length (aa) 1786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.6E-25 1333 1461
PF00512 HisKA His Kinase A (phospho-acceptor) domain 3.3E-19 1221 1286
PF08447 PAS_3 PAS fold 3.3E-11 918 1000

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 890 1775 1.0E-123
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1165 1458 1.0E-53
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1149 1472 3.0E-51
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1216 1490 2.0E-49
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1218 1460 4.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 890 1775 1.0E-123
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1165 1458 1.0E-53
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1149 1472 3.0E-51
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1216 1490 2.0E-49
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1218 1460 4.0E-48
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 1221 1462 1.0E-47
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1166 1489 6.0E-45
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1137 1467 7.0E-45
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1204 1505 6.0E-44
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1196 1488 6.0E-44
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1204 1460 1.0E-43
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 1216 1479 3.0E-43
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 1216 1464 6.0E-43
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 1216 1464 6.0E-43
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 1216 1464 6.0E-43
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1204 1491 2.0E-42
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1222 1476 3.0E-42
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1180 1460 3.0E-41
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1216 1470 5.0E-41
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 1204 1463 6.0E-41
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1208 1460 1.0E-40
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1208 1460 1.0E-40
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 1216 1471 1.0E-40
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 1216 1471 2.0E-40
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1216 1456 5.0E-38
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1204 1484 1.0E-37
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 1216 1483 1.0E-37
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 1218 1471 3.0E-37
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 1218 1465 4.0E-37
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 1218 1471 4.0E-37
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 1212 1459 9.0E-37
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1216 1470 2.0E-36
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1216 1470 2.0E-36
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 1218 1464 2.0E-35
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 1218 1465 4.0E-35
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 1221 1475 5.0E-35
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1212 1468 2.0E-34
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 1218 1464 2.0E-34
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 1199 1475 5.0E-34
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 1199 1475 5.0E-34
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 1199 1475 5.0E-34
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1218 1462 2.0E-33
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1215 1459 5.0E-33
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 1218 1471 1.0E-32
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1161 1442 1.0E-32
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 1218 1464 2.0E-32
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1222 1470 2.0E-32
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 1218 1464 2.0E-32
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 1214 1441 3.0E-32
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 1218 1464 3.0E-32
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 1218 1464 3.0E-32
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 1199 1464 5.0E-32
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 1218 1465 7.0E-32
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 1199 1464 8.0E-32
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 1218 1475 9.0E-32
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 1220 1459 2.0E-31
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 1199 1464 2.0E-31
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 1218 1464 3.0E-31
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1216 1486 6.0E-31
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 1205 1467 7.0E-31
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 1218 1464 9.0E-31
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 1208 1461 1.0E-30
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1216 1486 1.0E-30
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 1218 1465 2.0E-30
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 1218 1465 3.0E-30
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 1220 1459 3.0E-30
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 1205 1467 4.0E-30
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 1216 1459 5.0E-30
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 1214 1459 1.0E-29
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 1205 1459 1.0E-29
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1216 1457 2.0E-29
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1216 1457 2.0E-29
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1216 1458 3.0E-29
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1216 1458 4.0E-29
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1206 1470 1.0E-28
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1198 1367 3.0E-27
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1216 1463 2.0E-25
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 1207 1457 1.0E-24
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 1202 1472 2.0E-24
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 1216 1459 3.0E-24
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 1216 1459 3.0E-24
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 1216 1459 3.0E-24
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 1216 1459 3.0E-24
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 1216 1459 4.0E-24
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 1216 1459 4.0E-24
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 1216 1459 4.0E-24
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 1216 1459 4.0E-24
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 1216 1470 6.0E-23
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 1190 1490 1.0E-22
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 1190 1490 1.0E-22
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 1190 1490 1.0E-22
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 1216 1455 1.0E-22
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 1190 1476 2.0E-22
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 1196 1459 7.0E-22
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 1206 1456 2.0E-21
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 1190 1524 2.0E-21
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1216 1364 5.0E-21
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 1190 1492 8.0E-21
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 1222 1458 2.0E-20
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 1204 1457 1.0E-19
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 1222 1456 2.0E-19
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 1164 1456 5.0E-19
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 1164 1456 5.0E-19
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 1164 1456 6.0E-19
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 1164 1456 6.0E-19
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 1164 1456 7.0E-19
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 1164 1456 7.0E-19
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 1164 1456 7.0E-19
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 1164 1456 7.0E-19
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 1213 1458 1.0E-18
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1215 1457 2.0E-18
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 1214 1459 8.0E-18
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 1213 1456 9.0E-18
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 1213 1456 9.0E-18
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 1213 1456 9.0E-18
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 1200 1458 3.0E-17
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 1146 1458 3.0E-17
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 1205 1486 7.0E-17
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 1196 1459 2.0E-16
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 1205 1461 5.0E-16
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 1213 1458 5.0E-16
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 1200 1458 7.0E-16
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 1214 1459 2.0E-15
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 1215 1459 2.0E-15
sp|Q2JWK9|SASA_SYNJA Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-3-3Ab) GN=sasA PE=3 SV=1 1214 1459 5.0E-15
sp|Q4L6C5|ARLS_STAHJ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=arlS PE=3 SV=1 1214 1456 5.0E-15
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 1219 1459 7.0E-15
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 1211 1463 1.0E-14
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 1197 1458 2.0E-14
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 1214 1456 2.0E-14
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1333 1475 2.0E-14
sp|Q8CSL7|ARLS_STAES Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arlS PE=3 SV=1 1214 1459 2.0E-14
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 1221 1456 2.0E-14
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 1211 1459 3.0E-14
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 1213 1459 8.0E-14
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 1207 1457 1.0E-13
sp|Q5HPC4|ARLS_STAEQ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=arlS PE=3 SV=1 1214 1459 1.0E-13
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 1214 1458 2.0E-13
sp|Q49XM6|ARLS_STAS1 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=arlS PE=3 SV=1 1214 1459 2.0E-13
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 1219 1458 2.0E-13
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 1219 1458 2.0E-13
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 1219 1458 2.0E-13
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 1217 1458 2.0E-13
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 1214 1458 3.0E-13
sp|Q49ZT9|HSSS_STAS1 Heme sensor protein HssS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hssS PE=3 SV=1 1211 1459 3.0E-13
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1221 1460 4.0E-13
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1221 1460 4.0E-13
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 1206 1458 4.0E-13
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 1215 1460 4.0E-13
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 1213 1459 5.0E-13
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 1213 1458 5.0E-13
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 417 681 6.0E-13
sp|Q7U871|SASA_SYNPX Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain WH8102) GN=sasA PE=3 SV=1 1215 1460 9.0E-13
sp|P94608|KDPD_CLOAB Sensor protein KdpD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpD PE=3 SV=2 1222 1459 1.0E-12
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 1195 1459 1.0E-12
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 1195 1459 1.0E-12
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 1195 1459 1.0E-12
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 1195 1459 1.0E-12
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|Q7BWI3|SASA_PROMA Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=sasA PE=3 SV=1 1215 1476 1.0E-12
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 1195 1459 1.0E-12
sp|P55552|Y4LL_RHISN Uncharacterized protein y4lL OS=Rhizobium sp. (strain NGR234) GN=NGR_a02630 PE=3 SV=1 942 1079 1.0E-12
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 1221 1468 2.0E-12
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 1195 1459 2.0E-12
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1199 1352 3.0E-12
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 1214 1459 4.0E-12
sp|P39664|SPHS_SYNE7 Sensor protein SphS OS=Synechococcus elongatus (strain PCC 7942) GN=sphS PE=1 SV=2 1214 1477 5.0E-12
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1389 1471 6.0E-12
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 1214 1456 6.0E-12
sp|P72292|CHVG_RHIME Sensor protein ChvG OS=Rhizobium meliloti (strain 1021) GN=chvG PE=3 SV=3 1211 1471 6.0E-12
sp|Q7V6P7|SASA_PROMM Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9313) GN=sasA PE=3 SV=1 1215 1460 8.0E-12
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 1219 1470 9.0E-12
sp|Q07737|CHVG_AGRFC Sensor protein ChvG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=chvG PE=3 SV=2 1211 1470 9.0E-12
sp|E5KK10|FILI_METH6 Methanogenesis regulatory histidine kinase FilI OS=Methanosaeta harundinacea (strain 6Ac) GN=filI PE=1 SV=1 1208 1466 1.0E-11
sp|Q6T5K2|ETR3_ORYSI Ethylene receptor 3 OS=Oryza sativa subsp. indica GN=ETR3 PE=2 SV=2 1218 1464 1.0E-11
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 1215 1460 2.0E-11
sp|Q3AYV8|SASA_SYNS9 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9902) GN=sasA PE=3 SV=1 1215 1460 2.0E-11
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 1214 1456 2.0E-11
sp|B2J946|SASA_NOSP7 Adaptive-response sensory-kinase SasA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sasA PE=3 SV=1 1215 1459 2.0E-11
sp|P23621|PHOR_PSEAE Phosphate regulon sensor protein PhoR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phoR PE=3 SV=2 1213 1457 2.0E-11
sp|Q0DWC7|ETR3_ORYSJ Ethylene receptor 3 OS=Oryza sativa subsp. japonica GN=ETR3 PE=2 SV=1 1218 1464 2.0E-11
sp|P39764|KINC_BACSU Sporulation kinase C OS=Bacillus subtilis (strain 168) GN=kinC PE=3 SV=1 1199 1456 3.0E-11
sp|P26489|FIXL_AZOC5 Sensor protein FixL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixL PE=3 SV=1 1300 1461 3.0E-11
sp|P9WGL1|MPRB_MYCTU Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mprB PE=1 SV=1 1208 1451 4.0E-11
sp|P9WGL0|MPRB_MYCTO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mprB PE=3 SV=1 1208 1451 4.0E-11
sp|A5U124|MPRB_MYCTA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mprB PE=3 SV=1 1208 1451 4.0E-11
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 1199 1456 4.0E-11
sp|A3Q5L8|MPRB_MYCSJ Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain JLS) GN=mprB PE=3 SV=1 1215 1456 4.0E-11
sp|Q4L8M0|HSSS_STAHJ Heme sensor protein HssS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hssS PE=3 SV=1 1211 1459 5.0E-11
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 1195 1459 6.0E-11
sp|Q7V113|SASA_PROMP Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=sasA PE=3 SV=1 1215 1459 6.0E-11
sp|Q5HHW5|SAES_STAAC Histidine protein kinase SaeS OS=Staphylococcus aureus (strain COL) GN=saeS PE=1 SV=1 1214 1459 7.0E-11
sp|Q2G2U1|SAES_STAA8 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain NCTC 8325) GN=saeS PE=1 SV=1 1214 1459 7.0E-11
sp|Q2FIT5|SAES_STAA3 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain USA300) GN=saeS PE=3 SV=1 1214 1459 7.0E-11
sp|A0PWB3|MPRB_MYCUA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium ulcerans (strain Agy99) GN=mprB PE=3 SV=1 1209 1452 7.0E-11
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 1217 1465 8.0E-11
sp|Q840P7|SAES_STAAE Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Newman) GN=saeS PE=1 SV=1 1214 1459 8.0E-11
sp|P33113|SPAK_BACIU Sensor histidine kinase SpaK OS=Bacillus subtilis GN=spaK PE=3 SV=3 1220 1444 9.0E-11
sp|Q8E3C7|DLTS_STRA3 Sensor protein DltS OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltS PE=3 SV=1 1219 1449 1.0E-10
sp|Q1B3X9|MPRB_MYCSS Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain MCS) GN=mprB PE=3 SV=1 1215 1456 1.0E-10
sp|A1UL69|MPRB_MYCSK Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain KMS) GN=mprB PE=3 SV=1 1215 1456 1.0E-10
sp|A2BRQ6|SASA_PROMS Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain AS9601) GN=sasA PE=3 SV=1 1215 1459 1.0E-10
sp|A3PDI2|SASA_PROM0 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9301) GN=sasA PE=3 SV=1 1215 1459 1.0E-10
sp|P16497|KINA_BACSU Sporulation kinase A OS=Bacillus subtilis (strain 168) GN=kinA PE=1 SV=2 1196 1459 1.0E-10
sp|Q7A1J2|SAES_STAAW Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MW2) GN=saeS PE=3 SV=1 1214 1459 1.0E-10
sp|Q6GBC5|SAES_STAAS Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MSSA476) GN=saeS PE=3 SV=1 1214 1459 1.0E-10
sp|Q6GIT7|SAES_STAAR Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MRSA252) GN=saeS PE=3 SV=1 1214 1459 1.0E-10
sp|Q7A6V4|SAES_STAAN Histidine protein kinase SaeS OS=Staphylococcus aureus (strain N315) GN=saeS PE=1 SV=1 1214 1459 1.0E-10
sp|Q99VR8|SAES_STAAM Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=saeS PE=3 SV=1 1214 1459 1.0E-10
sp|Q2YSM6|SAES_STAAB Histidine protein kinase SaeS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=saeS PE=3 SV=1 1214 1459 1.0E-10
sp|A0QBR0|MPRB_MYCA1 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium avium (strain 104) GN=mprB PE=3 SV=2 1199 1456 1.0E-10
sp|P0A4I6|CIAH_STRR6 Sensor protein CiaH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaH PE=3 SV=1 1215 1468 1.0E-10
sp|P0A4I5|CIAH_STRPN Sensor protein CiaH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaH PE=3 SV=1 1215 1468 1.0E-10
sp|Q8DXQ8|DLTS_STRA5 Sensor protein DltS OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltS PE=3 SV=1 1219 1449 1.0E-10
sp|A1KHB8|MPRB_MYCBP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprB PE=3 SV=1 1208 1451 2.0E-10
sp|Q7U0X3|MPRB_MYCBO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprB PE=1 SV=1 1208 1451 2.0E-10
sp|A8G5E7|SASA_PROM2 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9215) GN=sasA PE=3 SV=1 1215 1459 2.0E-10
sp|P0AE82|CPXA_ECOLI Sensor protein CpxA OS=Escherichia coli (strain K12) GN=cpxA PE=1 SV=1 1194 1453 2.0E-10
sp|P0AE83|CPXA_ECOL6 Sensor protein CpxA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cpxA PE=3 SV=1 1194 1453 2.0E-10
sp|P0AE84|CPXA_ECO57 Sensor protein CpxA OS=Escherichia coli O157:H7 GN=cpxA PE=3 SV=1 1194 1453 2.0E-10
sp|Q03069|DEGM_BACB2 Sensor protein DegM OS=Bacillus sp. (strain B21-2) GN=degM PE=3 SV=1 1221 1459 2.0E-10
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 1199 1451 2.0E-10
sp|P15939|NODV_BRADU Nodulation protein V OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodV PE=3 SV=1 1227 1458 3.0E-10
sp|Q06904|SASA_SYNE7 Adaptive-response sensory-kinase SasA OS=Synechococcus elongatus (strain PCC 7942) GN=sasA PE=1 SV=2 1273 1466 3.0E-10
sp|P21865|KDPD_ECOLI Sensor protein KdpD OS=Escherichia coli (strain K12) GN=kdpD PE=1 SV=2 1217 1459 4.0E-10
sp|O31661|KINE_BACSU Sporulation kinase E OS=Bacillus subtilis (strain 168) GN=kinE PE=1 SV=1 1204 1459 4.0E-10
sp|Q31AE8|SASA_PROM9 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9312) GN=sasA PE=3 SV=1 1215 1459 4.0E-10
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1380 1458 5.0E-10
sp|P37739|DCTS_RHOCA C4-dicarboxylate transport sensor protein DctS OS=Rhodobacter capsulatus GN=dctS PE=3 SV=1 1181 1473 5.0E-10
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 1216 1456 6.0E-10
sp|Q9ZHD4|SILS_SALTM Probable sensor kinase SilS OS=Salmonella typhimurium GN=silS PE=3 SV=1 1214 1445 6.0E-10
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 1216 1464 6.0E-10
sp|Q9Z5G7|MPRB_MYCLE Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium leprae (strain TN) GN=mprB PE=3 SV=1 1209 1451 8.0E-10
sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2 PE=3 SV=1 1209 1468 9.0E-10
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2 1221 1449 1.0E-09
sp|Q3M8A7|SASA_ANAVT Adaptive-response sensory-kinase SasA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=sasA PE=3 SV=1 1214 1459 1.0E-09
sp|Q8YR50|SASA_NOSS1 Adaptive-response sensory-kinase SasA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sasA PE=3 SV=1 1214 1459 1.0E-09
sp|Q8CTI3|SAES_STAES Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=saeS PE=3 SV=2 1197 1461 2.0E-09
sp|Q5HR29|SAES_STAEQ Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=saeS PE=3 SV=2 1197 1461 2.0E-09
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 1214 1459 2.0E-09
sp|A1TEL6|MPRB_MYCVP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprB PE=3 SV=1 1215 1451 2.0E-09
sp|A0R3I7|MPRB_MYCS2 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprB PE=3 SV=2 1215 1444 2.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1388 1459 2.0E-09
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 1220 1468 3.0E-09
sp|Q6GE72|HSSS_STAAR Heme sensor protein HssS OS=Staphylococcus aureus (strain MRSA252) GN=hssS PE=3 SV=1 1214 1459 5.0E-09
sp|Q8NV46|HSSS_STAAW Heme sensor protein HssS OS=Staphylococcus aureus (strain MW2) GN=hssS PE=3 SV=1 1214 1459 6.0E-09
sp|Q6G6V8|HSSS_STAAS Heme sensor protein HssS OS=Staphylococcus aureus (strain MSSA476) GN=hssS PE=3 SV=1 1214 1459 6.0E-09
sp|P19906|NTRB_VIBAL Nitrogen regulation protein NtrB OS=Vibrio alginolyticus GN=ntrB PE=3 SV=1 1176 1458 6.0E-09
sp|P23222|FIXL_BRADU Sensor protein FixL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixL PE=1 SV=1 1194 1470 6.0E-09
sp|A8Z553|HSSS_STAAT Heme sensor protein HssS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hssS PE=3 SV=1 1214 1459 7.0E-09
sp|A6QJK4|HSSS_STAAE Heme sensor protein HssS OS=Staphylococcus aureus (strain Newman) GN=hssS PE=1 SV=1 1214 1459 7.0E-09
sp|Q5HDJ3|HSSS_STAAC Heme sensor protein HssS OS=Staphylococcus aureus (strain COL) GN=hssS PE=3 SV=1 1214 1459 7.0E-09
sp|Q2FVQ8|HSSS_STAA8 Heme sensor protein HssS OS=Staphylococcus aureus (strain NCTC 8325) GN=hssS PE=3 SV=1 1214 1459 7.0E-09
sp|Q2FED4|HSSS_STAA3 Heme sensor protein HssS OS=Staphylococcus aureus (strain USA300) GN=hssS PE=3 SV=1 1214 1459 7.0E-09
sp|Q8XBY4|CUSS_ECO57 Sensor kinase CusS OS=Escherichia coli O157:H7 GN=cusS PE=3 SV=1 1214 1459 8.0E-09
sp|Q8GP19|RSSA_SERMA Swarming motility regulation sensor protein RssA OS=Serratia marcescens GN=rssA PE=1 SV=2 1211 1453 8.0E-09
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1369 1459 9.0E-09
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 1221 1474 9.0E-09
sp|Q7A3X0|HSSS_STAAN Heme sensor protein HssS OS=Staphylococcus aureus (strain N315) GN=hssS PE=3 SV=1 1214 1459 1.0E-08
sp|Q99RR5|HSSS_STAAM Heme sensor protein HssS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hssS PE=3 SV=1 1214 1459 1.0E-08
sp|A5IVE3|HSSS_STAA9 Heme sensor protein HssS OS=Staphylococcus aureus (strain JH9) GN=hssS PE=3 SV=1 1214 1459 1.0E-08
sp|A6U489|HSSS_STAA2 Heme sensor protein HssS OS=Staphylococcus aureus (strain JH1) GN=hssS PE=3 SV=1 1214 1459 1.0E-08
sp|A7X5Y6|HSSS_STAA1 Heme sensor protein HssS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hssS PE=3 SV=1 1214 1459 1.0E-08
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 1211 1461 1.0E-08
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1218 1369 2.0E-08
sp|Q2YZ23|HSSS_STAAB Heme sensor protein HssS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hssS PE=3 SV=1 1214 1459 2.0E-08
sp|Q7XX84|ETR2_ORYSJ Ethylene receptor 2 OS=Oryza sativa subsp. japonica GN=ETR2 PE=1 SV=1 1218 1370 2.0E-08
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens subsp. patens GN=PHY1 PE=2 SV=2 1191 1468 2.0E-08
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 1221 1474 2.0E-08
sp|P0A2D9|NTRB_SALTY Nitrogen regulation protein NR(II) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnL PE=3 SV=1 1206 1451 3.0E-08
sp|P0A2E0|NTRB_SALTI Nitrogen regulation protein NR(II) OS=Salmonella typhi GN=glnL PE=3 SV=1 1206 1451 3.0E-08
sp|P06218|NTRB_KLEOX Nitrogen regulation protein NtrB OS=Klebsiella oxytoca GN=ntrB PE=3 SV=1 1206 1451 4.0E-08
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 1214 1459 4.0E-08
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 1186 1449 4.0E-08
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 1186 1449 5.0E-08
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1205 1367 6.0E-08
sp|P0AFB7|NTRB_SHIFL Nitrogen regulation protein NR(II) OS=Shigella flexneri GN=glnL PE=3 SV=1 1206 1451 6.0E-08
sp|P0AFB5|NTRB_ECOLI Nitrogen regulation protein NR(II) OS=Escherichia coli (strain K12) GN=glnL PE=1 SV=1 1206 1451 6.0E-08
sp|P0AFB6|NTRB_ECO57 Nitrogen regulation protein NR(II) OS=Escherichia coli O157:H7 GN=glnL PE=3 SV=1 1206 1451 6.0E-08
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 1194 1469 7.0E-08
sp|P52101|GLRK_ECOLI Sensor histidine kinase GlrK OS=Escherichia coli (strain K12) GN=glrK PE=1 SV=3 1211 1469 9.0E-08
sp|Q8H1X1|ETR2_ORYSI Ethylene receptor 2 OS=Oryza sativa subsp. indica GN=ETR2 PE=2 SV=3 1218 1370 1.0E-07
sp|P0A4I8|CUTS_STRLI Sensor protein CutS OS=Streptomyces lividans GN=cutS PE=3 SV=1 1214 1466 3.0E-07
sp|P0A4I7|CUTS_STRCO Sensor protein CutS OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cutS PE=3 SV=1 1214 1466 3.0E-07
sp|Q8XA47|QSEE_ECO57 Sensor histidine kinase QseE OS=Escherichia coli O157:H7 GN=qseE PE=1 SV=2 1211 1469 3.0E-07
sp|P10955|FIXL_RHIME Sensor protein FixL OS=Rhizobium meliloti (strain 1021) GN=fixL PE=1 SV=2 1334 1459 3.0E-07
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 1211 1458 3.0E-07
sp|Q06240|VANS_ENTFC Sensor protein VanS OS=Enterococcus faecium GN=vanS PE=3 SV=1 1212 1469 6.0E-07
sp|Q8THF6|MSMS_METAC Methyl sulfide methyltransferase-associated sensor OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msmS PE=1 SV=1 1252 1454 6.0E-07
sp|O32193|CSSS_BACSU Sensor histidine kinase CssS OS=Bacillus subtilis (strain 168) GN=cssS PE=1 SV=2 1211 1440 7.0E-07
sp|O34989|YVRG_BACSU Sensor histidine kinase YvrG OS=Bacillus subtilis (strain 168) GN=yvrG PE=3 SV=2 1221 1457 7.0E-07
sp|Q55F68|CYAD_DICDI Adenylate cyclase, terminal-differentiation specific OS=Dictyostelium discoideum GN=acrA PE=1 SV=1 1193 1481 7.0E-07
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 1211 1473 8.0E-07
sp|P9WGL3|KDPD_MYCTU Sensor protein KdpD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpD PE=1 SV=1 1215 1471 8.0E-07
sp|Q04804|PFES_PSEAE Sensor protein PfeS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pfeS PE=1 SV=2 1214 1451 8.0E-07
sp|P9WGL2|KDPD_MYCTO Sensor protein KdpD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpD PE=3 SV=1 1215 1471 8.0E-07
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 1224 1459 8.0E-07
sp|P30733|PHYA_SOLTU Phytochrome A OS=Solanum tuberosum GN=PHYA PE=2 SV=2 1224 1466 9.0E-07
sp|Q8CRA8|HSSS_STAES Heme sensor protein HssS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hssS PE=3 SV=1 1211 1449 1.0E-06
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1214 1364 1.0E-06
sp|O34971|KDPD_RATRA Sensor protein KdpD OS=Rathayibacter rathayi GN=kdpD PE=3 SV=1 1215 1459 2.0E-06
sp|P28788|NTRB_PROHU Nitrogen regulation protein NR(II) OS=Proteus hauseri GN=ntrB PE=3 SV=1 1229 1452 3.0E-06
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PHYB PE=1 SV=1 1221 1479 3.0E-06
sp|Q52977|NTRB_RHIME Nitrogen regulation protein NtrB OS=Rhizobium meliloti (strain 1021) GN=ntrB PE=3 SV=2 1216 1471 4.0E-06
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1222 1379 6.0E-06
sp|P41503|NTRB_RHILP Nitrogen regulation protein NtrB OS=Rhizobium leguminosarum bv. phaseoli GN=ntrB PE=3 SV=1 1216 1469 6.0E-06
sp|P42498|PHYE_ARATH Phytochrome E OS=Arabidopsis thaliana GN=PHYE PE=1 SV=2 1214 1444 6.0E-06
sp|Q5HLN1|HSSS_STAEQ Heme sensor protein HssS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hssS PE=3 SV=1 1211 1449 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0005515 protein binding Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0140299 small molecule sensor activity No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0050789 regulation of biological process No
GO:0004673 protein histidine kinase activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0004672 protein kinase activity No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5313
MPKPASPVDDGTTTATATATARSPLTTASDSSPTRRQQGPSASTSSLARHGRVTPQLPSIIRDAKQKGALPAPES
QKQLNEYREKLAWDLEHRELTTRNLLIMPSEKTRVSPIPEEAIVTSLSTESGNTVRASFTPGPVVATPSYPFPRM
SVAGFQPSFYLQGSMSPHVLTTAPRTGLPLAIEVRGALDKVLSENSTPVSNLTFNPSGATPHHDDTAFDFPEPNL
YDLSLMLSAEPGLDAWWSTVVQIMRDVYKADRVTLSIPADSTDVENVPWGQKATFNQQEQDEFSMAYMDRGGSAM
PSIGRDVSDGPDADELAQSPFRPGLTSRHSYSSYEENKKQSPNRSPSAARRPADLTRSKSQLYTPRRAPSDDYTR
LNKDALDEHDAAEGRQQAIPSWEAPLMARVDGLGRVLPVLQALDYEADPLIDHTGVIRVLQRGRPVALTRSYPYL
PTADVGQPASGGHASCQHRTAPDAPKRPSRQRAESAPKLSSMFVGQARNKATSGDGVKTIASRLYDDDDQPRPPT
PRYDEYEQTPPSPWSQSPAPSPAVRADPKENPFFTDATVDEGCFNPTSSPPASYSGLPPPEAIGVENSWTVLHVP
LKHVLLSRPTRPFKLDASAMEQRSQQTARRDAADVDRASPEHKNGSAPIAILSILSPVIPYPSNLRRSLEHLAPH
MATSFSLCRHYSNLETELAGMQRKGPSTSGFGAVAPYPRHFDGVPLSPRPDLVRQQSLADSMTSPSDYSAISKSA
AGSPLGTPGWDPAARVTLADKRQPMGSPASGPQGGEGGGYFGSRLMRSSSARSKEHSPGDRRREQVTDLDDVNGG
DGPDESPKQNVDASHHRASSHSVLHSYGADFASTFQSLPPSSSLVSRPAAPRNGSLTTLGADMPPPSDRLKGLIL
DSLPAHVFVSLPRTGETVWVNSRFLSYRGQTVADLAADPWGSIHADDRDGYLKAWSHSLRTGEQFSRTVRIKRFD
GAYRWFYARAVASKDKRGVIMQFLGSYMDIHDQHIAELRAARQEEVEASEAKHRLLANLIPQIIFTATEDEGITF
ANEQWLSYTGQSFDDALNLGFMGHVHPDDLARCRIPTGRRKGPAGGKAEADGSDSSASGTIQGCRSPTGRSQLSR
SSSSGTESTSGPAPADLTELARQGIFKVTTDTSGRLSYTTEVRLRSKTGEYRWHLVRCVEIDTIDFGRGASSYFG
SATDINDHKILETKLKEAMESKSRFLSNMSHEIRTPLIGISGMVSFLQDTTLDEEQRDYTNTIQTSANSLIMIIN
DILDLSKVDAGMMKLKYEWFHTRSLIEDVNELVSTMAVAKRLELNYLVDANVPAWVKGDKVRIRQVLLNVIGNAI
KFTTEGEVFSRCRVFVEDDEAEEGEDGKDKRDANSTMVLQFVITDTGRGFSREEAELIFKPFSQIDGSSTRQHGG
SGLGLVISRQLVELHGGRMEGTAEPGKGSTFTFTARFGLPTAEDHPPSVSPAWGVPEPTYGLRPAQRAEANGIMV
SGEGPSPGGASSGSSDPSVASGRSVGGTTDRSSASSMHVTSSSNAQGLARFIEAAKASGHDVSQMRLDMVDRSRT
ATPDQQQPTRPLMYSILVICPQYHSREATTQHIEMTLPKEVPHQMTALAAVDEAHKYIGGESAMRFTHIVLNLAS
AEAILDVLDQISRSAKARRTTVLILTDSVQRQAVLKLAAETDHGRLLADKLVTFIYKPVKPSRLAVIFDPDKVRD
LSTDRNRSTAQQMVESQKASYHEIERRMGNKGYRVLLVEDNPVNQKVLTKCCRSRTGTTR*
Coding >Ophun1|5313
ATGCCGAAGCCCGCCTCTCCAGTCGACGACGGCACGACTACGGCGACGGCGACGGCGACGGCGAGGTCTCCCCTG
ACGACGGCTTCGGATTCGTCCCCGACGCGTCGCCAGCAGGGCCCCTCTGCCTCGACCTCGAGCCTCGCCAGACAT
GGACGTGTGACGCCTCAGCTGCCTTCCATCATCCGAGATGCCAAGCAAAAGGGCGCGCTGCCTGCGCCCGAGTCG
CAGAAGCAGCTCAACGAGTACCGCGAGAAGCTGGCCTGGGACCTCGAGCATAGAGAGCTCACGACCAGGAACCTG
CTCATCATGCCCTCGGAAAAGACTCGTGTCTCGCCCATCCCCGAAGAAGCCATCGTCACCTCACTATCAACCGAG
TCCGGAAACACGGTCCGCGCTTCCTTCACCCCCGGCCCCGTCGTGGCCACGCCTTCGTACCCTTTCCCCCGCATG
TCCGTCGCCGGCTTCCAGCCCTCGTTCTATCTCCAAGGCTCAATGTCGCCTCACGTCCTGACGACGGCTCCTCGC
ACCGGTCTGCCGCTCGCCATCGAGGTGCGAGGCGCCCTCGACAAGGTCCTGTCGGAGAATTCCACGCCAGTTTCC
AACCTGACCTTTAACCCCTCGGGCGCCACGCCGCACCATGACGACACCGCCTTCGACTTCCCCGAACCCAACCTC
TACGACCTGTCACTCATGCTCAGCGCAGAGCCGGGCCTCGACGCCTGGTGGAGCACCGTCGTCCAGATCATGAGA
GACGTCTACAAGGCCGACCGCGTCACCCTCTCCATCCCGGCCGACTCCACCGACGTCGAAAACGTGCCCTGGGGC
CAAAAAGCCACCTTTAACCAGCAGGAGCAGGATGAGTTTAGCATGGCCTACATGGACCGTGGCGGCAGTGCCATG
CCGAGCATCGGCCGTGACGTCTCGGACGGCCCGGACGCCGACGAACTGGCACAATCGCCCTTCCGGCCCGGCCTC
ACCAGCCGTCACTCCTATTCATCGTACGAAGAGAACAAGAAGCAGTCGCCCAACAGAAGCCCGAGCGCGGCGCGG
CGGCCGGCAGACCTCACGCGGAGCAAGTCTCAGCTATATACGCCCCGACGGGCCCCGAGCGACGACTACACGAGG
CTCAACAAGGACGCTCTCGACGAACACGACGCCGCAGAGGGGAGGCAACAGGCCATACCTAGCTGGGAGGCCCCC
CTGATGGCTCGTGTCGACGGCCTGGGTCGCGTGCTGCCCGTTCTGCAGGCGCTCGACTACGAGGCCGACCCTCTC
ATCGACCACACCGGCGTCATCCGGGTGTTGCAGCGGGGGAGACCGGTGGCCTTGACCAGGAGCTATCCCTACCTC
CCCACCGCCGACGTCGGCCAGCCCGCGAGTGGCGGCCACGCCTCGTGCCAGCACAGGACGGCCCCGGACGCCCCC
AAGAGGCCCAGCAGGCAGCGGGCCGAGTCGGCGCCCAAGCTGTCGTCCATGTTTGTCGGCCAGGCGCGGAACAAG
GCCACGTCGGGCGACGGCGTCAAGACCATCGCGTCCCGCCTCTACGACGACGACGACCAGCCGAGACCGCCGACG
CCACGGTACGATGAGTATGAGCAGACGCCGCCGTCGCCGTGGTCTCAGTCGCCAGCGCCGTCGCCCGCGGTACGG
GCTGATCCTAAAGAGAACCCCTTCTTCACCGACGCCACCGTCGACGAGGGATGCTTTAACCCGACGTCGTCGCCC
CCTGCCAGCTACTCGGGCCTGCCGCCGCCCGAGGCCATCGGCGTCGAAAACTCGTGGACGGTGCTCCACGTCCCC
CTCAAGCACGTCCTGCTCTCGAGGCCGACGCGCCCTTTCAAGCTCGACGCCTCCGCCATGGAGCAGCGGTCTCAG
CAGACGGCCCGTCGGGACGCGGCCGACGTCGATCGCGCCTCGCCCGAGCACAAGAACGGCTCGGCCCCGATCGCC
ATCCTCTCCATCCTGAGTCCCGTCATACCCTATCCTTCCAACCTGAGGCGATCACTGGAACACCTCGCGCCGCAC
ATGGCCACGTCGTTTTCGCTGTGCCGGCACTACTCCAACCTCGAGACGGAGCTGGCCGGCATGCAGCGCAAGGGA
CCGTCGACTTCGGGCTTCGGCGCCGTGGCCCCTTATCCGCGGCACTTCGACGGCGTCCCGCTCTCGCCGCGGCCC
GACCTGGTGCGCCAGCAGTCACTGGCCGACAGCATGACGAGCCCCAGCGACTACTCGGCCATTTCGAAGAGCGCG
GCGGGATCCCCCTTGGGAACGCCCGGCTGGGATCCGGCGGCCCGCGTCACCCTGGCCGACAAGCGGCAGCCGATG
GGAAGCCCGGCCTCGGGGCCCCAGGGCGGCGAGGGTGGTGGATACTTTGGGAGTAGGCTGATGAGGTCCTCCTCG
GCAAGGTCCAAAGAGCACTCGCCGGGAGACAGGAGGCGGGAGCAGGTGACGGATCTCGACGATGTTAATGGCGGA
GACGGGCCCGACGAGTCCCCGAAGCAGAACGTGGACGCCTCCCATCACCGGGCCTCGTCGCATTCCGTTCTCCAC
AGCTACGGAGCCGACTTCGCCTCGACCTTTCAATCCCTGCCGCCGAGCTCGAGCCTCGTCAGCAGGCCGGCGGCG
CCTCGGAACGGCTCGCTGACGACGCTCGGGGCCGACATGCCGCCGCCTTCGGACCGGCTCAAGGGCCTGATCCTC
GACTCTCTGCCGGCGCACGTGTTCGTGTCGCTGCCGCGGACGGGCGAGACGGTGTGGGTGAACAGCCGGTTCCTG
TCGTACCGCGGGCAGACGGTGGCCGATCTGGCGGCGGACCCCTGGGGCAGCATCCACGCCGACGACCGCGACGGC
TACCTCAAGGCCTGGAGCCACTCGCTACGGACCGGAGAGCAGTTCTCGAGGACGGTGCGGATCAAGCGCTTCGAC
GGCGCGTACCGCTGGTTCTACGCCCGGGCGGTGGCGTCCAAGGACAAACGGGGCGTCATTATGCAGTTTCTGGGC
TCGTACATGGATATCCACGACCAGCACATCGCCGAGTTGAGGGCCGCGCGACAGGAGGAGGTGGAGGCGTCCGAG
GCGAAGCACCGGCTGCTGGCCAACCTGATACCGCAAATCATCTTTACCGCCACCGAGGACGAGGGCATCACGTTT
GCCAACGAGCAGTGGCTGTCGTACACGGGGCAGAGCTTCGACGACGCGTTGAATCTGGGCTTCATGGGGCACGTG
CATCCGGACGACCTGGCCAGGTGTCGGATCCCAACCGGACGGCGCAAGGGGCCGGCTGGCGGCAAGGCCGAGGCG
GACGGCTCCGACTCGTCGGCGTCGGGCACGATCCAGGGATGTCGGTCACCGACGGGCCGGTCGCAGCTGTCTAGG
AGCAGCAGCTCCGGGACCGAGTCGACGTCCGGGCCGGCGCCTGCGGACCTGACGGAGCTGGCGAGGCAGGGCATC
TTCAAGGTGACGACGGACACGAGCGGGAGGCTATCGTACACGACCGAGGTGCGGCTTCGGTCCAAGACGGGCGAG
TATCGCTGGCACCTGGTGCGGTGCGTGGAGATCGATACCATCGACTTTGGCCGCGGTGCCAGCTCGTACTTTGGC
TCGGCTACGGACATCAACGACCACAAGATCCTCGAGACGAAGCTGAAGGAGGCCATGGAGTCCAAGAGCCGGTTC
CTCAGCAACATGTCGCACGAGATCCGGACGCCGCTCATTGGCATCTCGGGCATGGTCAGCTTCCTGCAAGACACG
ACGCTGGACGAGGAGCAGCGCGACTACACCAACACGATCCAGACGAGCGCGAACAGCCTGATTATGATAATCAAC
GACATCCTCGACCTGTCCAAGGTAGACGCCGGCATGATGAAGCTCAAGTACGAGTGGTTCCACACGAGATCGCTC
ATCGAGGACGTCAACGAGCTGGTGTCGACCATGGCCGTGGCCAAGCGGCTCGAGCTCAACTACCTGGTGGACGCC
AACGTTCCGGCTTGGGTCAAGGGAGACAAGGTGCGGATACGCCAGGTGCTGCTCAACGTCATCGGCAACGCCATC
AAGTTTACGACCGAGGGGGAAGTGTTTAGCCGGTGCCGCGTCTTTGTCGAGGACGACGAGGCGGAAGAGGGGGAG
GATGGCAAGGACAAGCGAGACGCCAACTCGACCATGGTGCTGCAGTTCGTCATCACCGACACCGGCCGGGGCTTC
TCCCGGGAAGAGGCCGAGCTCATCTTCAAGCCCTTTAGCCAGATCGACGGCAGCAGCACGCGGCAGCACGGCGGC
AGCGGGCTGGGTCTCGTCATCTCACGGCAGCTCGTGGAGCTCCACGGAGGCCGGATGGAGGGCACGGCCGAGCCG
GGCAAGGGGTCGACGTTTACCTTTACGGCGCGGTTCGGCCTGCCGACGGCCGAGGACCATCCGCCGTCGGTATCG
CCGGCGTGGGGCGTGCCGGAGCCGACGTACGGGCTGCGGCCGGCGCAGAGGGCCGAGGCCAACGGCATCATGGTC
TCGGGCGAAGGACCGTCGCCGGGCGGTGCGTCGTCGGGCAGCTCGGATCCTTCGGTGGCTTCGGGCCGGTCGGTG
GGCGGCACGACGGACCGGTCTTCGGCTTCGTCGATGCACGTCACCAGTAGCAGCAACGCTCAGGGGCTGGCGCGC
TTCATCGAGGCGGCCAAGGCCAGCGGACATGACGTCTCGCAGATGAGGCTCGACATGGTGGACCGCAGCAGGACA
GCGACACCGGACCAGCAGCAGCCGACGCGGCCTCTCATGTACTCGATCCTGGTCATCTGTCCGCAGTATCACAGC
CGCGAGGCGACGACGCAGCACATCGAGATGACGCTGCCCAAGGAGGTCCCTCACCAGATGACGGCGCTGGCGGCC
GTCGACGAGGCGCACAAGTACATTGGCGGCGAATCGGCCATGCGGTTCACGCACATTGTGCTCAACCTGGCCTCG
GCCGAAGCCATCCTCGACGTGCTGGACCAGATCTCGCGATCGGCCAAGGCGCGGCGGACGACGGTCCTGATCCTG
ACCGACTCGGTGCAGCGGCAGGCGGTGCTCAAGCTGGCGGCGGAGACGGACCACGGCCGGCTGCTGGCGGACAAG
CTGGTGACGTTCATCTACAAGCCCGTCAAGCCCTCGAGGCTGGCCGTCATCTTCGACCCGGACAAGGTGCGCGAC
CTCAGCACGGACCGCAACCGGTCGACGGCGCAGCAGATGGTGGAGAGCCAAAAGGCCAGCTATCACGAGATTGAG
CGGCGGATGGGCAACAAGGGCTACCGCGTGCTGCTGGTCGAGGACAACCCGGTCAACCAAAAGGTGCTGACCAAG
TGCTGTCGAAGCCGCACCGGCACTACTCGCTGA
Transcript >Ophun1|5313
ATGCCGAAGCCCGCCTCTCCAGTCGACGACGGCACGACTACGGCGACGGCGACGGCGACGGCGAGGTCTCCCCTG
ACGACGGCTTCGGATTCGTCCCCGACGCGTCGCCAGCAGGGCCCCTCTGCCTCGACCTCGAGCCTCGCCAGACAT
GGACGTGTGACGCCTCAGCTGCCTTCCATCATCCGAGATGCCAAGCAAAAGGGCGCGCTGCCTGCGCCCGAGTCG
CAGAAGCAGCTCAACGAGTACCGCGAGAAGCTGGCCTGGGACCTCGAGCATAGAGAGCTCACGACCAGGAACCTG
CTCATCATGCCCTCGGAAAAGACTCGTGTCTCGCCCATCCCCGAAGAAGCCATCGTCACCTCACTATCAACCGAG
TCCGGAAACACGGTCCGCGCTTCCTTCACCCCCGGCCCCGTCGTGGCCACGCCTTCGTACCCTTTCCCCCGCATG
TCCGTCGCCGGCTTCCAGCCCTCGTTCTATCTCCAAGGCTCAATGTCGCCTCACGTCCTGACGACGGCTCCTCGC
ACCGGTCTGCCGCTCGCCATCGAGGTGCGAGGCGCCCTCGACAAGGTCCTGTCGGAGAATTCCACGCCAGTTTCC
AACCTGACCTTTAACCCCTCGGGCGCCACGCCGCACCATGACGACACCGCCTTCGACTTCCCCGAACCCAACCTC
TACGACCTGTCACTCATGCTCAGCGCAGAGCCGGGCCTCGACGCCTGGTGGAGCACCGTCGTCCAGATCATGAGA
GACGTCTACAAGGCCGACCGCGTCACCCTCTCCATCCCGGCCGACTCCACCGACGTCGAAAACGTGCCCTGGGGC
CAAAAAGCCACCTTTAACCAGCAGGAGCAGGATGAGTTTAGCATGGCCTACATGGACCGTGGCGGCAGTGCCATG
CCGAGCATCGGCCGTGACGTCTCGGACGGCCCGGACGCCGACGAACTGGCACAATCGCCCTTCCGGCCCGGCCTC
ACCAGCCGTCACTCCTATTCATCGTACGAAGAGAACAAGAAGCAGTCGCCCAACAGAAGCCCGAGCGCGGCGCGG
CGGCCGGCAGACCTCACGCGGAGCAAGTCTCAGCTATATACGCCCCGACGGGCCCCGAGCGACGACTACACGAGG
CTCAACAAGGACGCTCTCGACGAACACGACGCCGCAGAGGGGAGGCAACAGGCCATACCTAGCTGGGAGGCCCCC
CTGATGGCTCGTGTCGACGGCCTGGGTCGCGTGCTGCCCGTTCTGCAGGCGCTCGACTACGAGGCCGACCCTCTC
ATCGACCACACCGGCGTCATCCGGGTGTTGCAGCGGGGGAGACCGGTGGCCTTGACCAGGAGCTATCCCTACCTC
CCCACCGCCGACGTCGGCCAGCCCGCGAGTGGCGGCCACGCCTCGTGCCAGCACAGGACGGCCCCGGACGCCCCC
AAGAGGCCCAGCAGGCAGCGGGCCGAGTCGGCGCCCAAGCTGTCGTCCATGTTTGTCGGCCAGGCGCGGAACAAG
GCCACGTCGGGCGACGGCGTCAAGACCATCGCGTCCCGCCTCTACGACGACGACGACCAGCCGAGACCGCCGACG
CCACGGTACGATGAGTATGAGCAGACGCCGCCGTCGCCGTGGTCTCAGTCGCCAGCGCCGTCGCCCGCGGTACGG
GCTGATCCTAAAGAGAACCCCTTCTTCACCGACGCCACCGTCGACGAGGGATGCTTTAACCCGACGTCGTCGCCC
CCTGCCAGCTACTCGGGCCTGCCGCCGCCCGAGGCCATCGGCGTCGAAAACTCGTGGACGGTGCTCCACGTCCCC
CTCAAGCACGTCCTGCTCTCGAGGCCGACGCGCCCTTTCAAGCTCGACGCCTCCGCCATGGAGCAGCGGTCTCAG
CAGACGGCCCGTCGGGACGCGGCCGACGTCGATCGCGCCTCGCCCGAGCACAAGAACGGCTCGGCCCCGATCGCC
ATCCTCTCCATCCTGAGTCCCGTCATACCCTATCCTTCCAACCTGAGGCGATCACTGGAACACCTCGCGCCGCAC
ATGGCCACGTCGTTTTCGCTGTGCCGGCACTACTCCAACCTCGAGACGGAGCTGGCCGGCATGCAGCGCAAGGGA
CCGTCGACTTCGGGCTTCGGCGCCGTGGCCCCTTATCCGCGGCACTTCGACGGCGTCCCGCTCTCGCCGCGGCCC
GACCTGGTGCGCCAGCAGTCACTGGCCGACAGCATGACGAGCCCCAGCGACTACTCGGCCATTTCGAAGAGCGCG
GCGGGATCCCCCTTGGGAACGCCCGGCTGGGATCCGGCGGCCCGCGTCACCCTGGCCGACAAGCGGCAGCCGATG
GGAAGCCCGGCCTCGGGGCCCCAGGGCGGCGAGGGTGGTGGATACTTTGGGAGTAGGCTGATGAGGTCCTCCTCG
GCAAGGTCCAAAGAGCACTCGCCGGGAGACAGGAGGCGGGAGCAGGTGACGGATCTCGACGATGTTAATGGCGGA
GACGGGCCCGACGAGTCCCCGAAGCAGAACGTGGACGCCTCCCATCACCGGGCCTCGTCGCATTCCGTTCTCCAC
AGCTACGGAGCCGACTTCGCCTCGACCTTTCAATCCCTGCCGCCGAGCTCGAGCCTCGTCAGCAGGCCGGCGGCG
CCTCGGAACGGCTCGCTGACGACGCTCGGGGCCGACATGCCGCCGCCTTCGGACCGGCTCAAGGGCCTGATCCTC
GACTCTCTGCCGGCGCACGTGTTCGTGTCGCTGCCGCGGACGGGCGAGACGGTGTGGGTGAACAGCCGGTTCCTG
TCGTACCGCGGGCAGACGGTGGCCGATCTGGCGGCGGACCCCTGGGGCAGCATCCACGCCGACGACCGCGACGGC
TACCTCAAGGCCTGGAGCCACTCGCTACGGACCGGAGAGCAGTTCTCGAGGACGGTGCGGATCAAGCGCTTCGAC
GGCGCGTACCGCTGGTTCTACGCCCGGGCGGTGGCGTCCAAGGACAAACGGGGCGTCATTATGCAGTTTCTGGGC
TCGTACATGGATATCCACGACCAGCACATCGCCGAGTTGAGGGCCGCGCGACAGGAGGAGGTGGAGGCGTCCGAG
GCGAAGCACCGGCTGCTGGCCAACCTGATACCGCAAATCATCTTTACCGCCACCGAGGACGAGGGCATCACGTTT
GCCAACGAGCAGTGGCTGTCGTACACGGGGCAGAGCTTCGACGACGCGTTGAATCTGGGCTTCATGGGGCACGTG
CATCCGGACGACCTGGCCAGGTGTCGGATCCCAACCGGACGGCGCAAGGGGCCGGCTGGCGGCAAGGCCGAGGCG
GACGGCTCCGACTCGTCGGCGTCGGGCACGATCCAGGGATGTCGGTCACCGACGGGCCGGTCGCAGCTGTCTAGG
AGCAGCAGCTCCGGGACCGAGTCGACGTCCGGGCCGGCGCCTGCGGACCTGACGGAGCTGGCGAGGCAGGGCATC
TTCAAGGTGACGACGGACACGAGCGGGAGGCTATCGTACACGACCGAGGTGCGGCTTCGGTCCAAGACGGGCGAG
TATCGCTGGCACCTGGTGCGGTGCGTGGAGATCGATACCATCGACTTTGGCCGCGGTGCCAGCTCGTACTTTGGC
TCGGCTACGGACATCAACGACCACAAGATCCTCGAGACGAAGCTGAAGGAGGCCATGGAGTCCAAGAGCCGGTTC
CTCAGCAACATGTCGCACGAGATCCGGACGCCGCTCATTGGCATCTCGGGCATGGTCAGCTTCCTGCAAGACACG
ACGCTGGACGAGGAGCAGCGCGACTACACCAACACGATCCAGACGAGCGCGAACAGCCTGATTATGATAATCAAC
GACATCCTCGACCTGTCCAAGGTAGACGCCGGCATGATGAAGCTCAAGTACGAGTGGTTCCACACGAGATCGCTC
ATCGAGGACGTCAACGAGCTGGTGTCGACCATGGCCGTGGCCAAGCGGCTCGAGCTCAACTACCTGGTGGACGCC
AACGTTCCGGCTTGGGTCAAGGGAGACAAGGTGCGGATACGCCAGGTGCTGCTCAACGTCATCGGCAACGCCATC
AAGTTTACGACCGAGGGGGAAGTGTTTAGCCGGTGCCGCGTCTTTGTCGAGGACGACGAGGCGGAAGAGGGGGAG
GATGGCAAGGACAAGCGAGACGCCAACTCGACCATGGTGCTGCAGTTCGTCATCACCGACACCGGCCGGGGCTTC
TCCCGGGAAGAGGCCGAGCTCATCTTCAAGCCCTTTAGCCAGATCGACGGCAGCAGCACGCGGCAGCACGGCGGC
AGCGGGCTGGGTCTCGTCATCTCACGGCAGCTCGTGGAGCTCCACGGAGGCCGGATGGAGGGCACGGCCGAGCCG
GGCAAGGGGTCGACGTTTACCTTTACGGCGCGGTTCGGCCTGCCGACGGCCGAGGACCATCCGCCGTCGGTATCG
CCGGCGTGGGGCGTGCCGGAGCCGACGTACGGGCTGCGGCCGGCGCAGAGGGCCGAGGCCAACGGCATCATGGTC
TCGGGCGAAGGACCGTCGCCGGGCGGTGCGTCGTCGGGCAGCTCGGATCCTTCGGTGGCTTCGGGCCGGTCGGTG
GGCGGCACGACGGACCGGTCTTCGGCTTCGTCGATGCACGTCACCAGTAGCAGCAACGCTCAGGGGCTGGCGCGC
TTCATCGAGGCGGCCAAGGCCAGCGGACATGACGTCTCGCAGATGAGGCTCGACATGGTGGACCGCAGCAGGACA
GCGACACCGGACCAGCAGCAGCCGACGCGGCCTCTCATGTACTCGATCCTGGTCATCTGTCCGCAGTATCACAGC
CGCGAGGCGACGACGCAGCACATCGAGATGACGCTGCCCAAGGAGGTCCCTCACCAGATGACGGCGCTGGCGGCC
GTCGACGAGGCGCACAAGTACATTGGCGGCGAATCGGCCATGCGGTTCACGCACATTGTGCTCAACCTGGCCTCG
GCCGAAGCCATCCTCGACGTGCTGGACCAGATCTCGCGATCGGCCAAGGCGCGGCGGACGACGGTCCTGATCCTG
ACCGACTCGGTGCAGCGGCAGGCGGTGCTCAAGCTGGCGGCGGAGACGGACCACGGCCGGCTGCTGGCGGACAAG
CTGGTGACGTTCATCTACAAGCCCGTCAAGCCCTCGAGGCTGGCCGTCATCTTCGACCCGGACAAGGTGCGCGAC
CTCAGCACGGACCGCAACCGGTCGACGGCGCAGCAGATGGTGGAGAGCCAAAAGGCCAGCTATCACGAGATTGAG
CGGCGGATGGGCAACAAGGGCTACCGCGTGCTGCTGGTCGAGGACAACCCGGTCAACCAAAAGGTGCTGACCAAG
TGCTGTCGAAGCCGCACCGGCACTACTCGCTGA
Gene >Ophun1|5313
ATGCCGAAGCCCGCCTCTCCAGTCGACGACGGCACGACTACGGCGACGGCGACGGCGACGGCGAGGTCTCCCCTG
ACGACGGCTTCGGATTCGTCCCCGACGCGTCGCCAGCAGGGCCCCTCTGCCTCGACCTCGAGCCTCGCCAGACAT
GGACGTGTGACGCCTCAGCTGCCTTCCATCATCCGAGATGCCAAGCAAAAGGGCGCGCTGCCTGCGCCCGAGTCG
CAGAAGCAGCTCAACGAGTACCGCGAGAAGCTGGCCTGGGACCTCGAGCATAGAGAGCTCACGACCAGGAACCTG
CTCATCATGCCCTCGGAAAAGACTCGTGTCTCGCCCATCCCCGAAGAAGCCATCGTCACCTCACTATCAACCGAG
TCCGGAAACACGGTCCGCGCTTCCTTCACCCCCGGCCCCGTCGTGGCCACGCCTTCGTACCCTTTCCCCCGCATG
TCCGTCGCCGGCTTCCAGCCCTCGTTCTATCTCCAAGGCTCAATGTCGCCTCACGTCCTGACGACGGCTCCTCGC
ACCGGTCTGCCGCTCGCCATCGAGGTGCGAGGCGCCCTCGACAAGGTCCTGTCGGAGAATTCCACGCCAGTTTCC
AACCTGACCTTTAACCCCTCGGGCGCCACGCCGCACCATGACGACACCGCCTTCGACTTCCCCGAACCCAACCTC
TACGACCTGTCACTCATGCTCAGCGCAGAGCCGGGCCTCGACGCCTGGTGGAGCACCGTCGTCCAGATCATGAGA
GACGTCTACAAGGCCGACCGCGTCACCCTCTCCATCCCGGCCGACTCCACCGACGTCGAAAACGTGCCCTGGGGC
CAAAAAGCCACCTTTAACCAGCAGGAGCAGGATGAGTTTAGCATGGCCTACATGGACCGTGGCGGCAGTGCCATG
CCGAGCATCGGCCGTGACGTCTCGGACGGCCCGGACGCCGACGAACTGGCACAATCGCCCTTCCGGCCCGGCCTC
ACCAGCCGTCACTCCTATTCATCGTACGAAGAGAACAAGAAGCAGTCGCCCAACAGAAGCCCGAGCGCGGCGCGG
CGGCCGGCAGACCTCACGCGGAGCAAGTCTCAGCTATATACGCCCCGACGGGCCCCGAGCGACGACTACACGAGG
CTCAACAAGGACGCTCTCGACGAACACGACGCCGCAGAGGGGAGGCAACAGGCCATACCTAGCTGGGAGGCCCCC
CTGATGGCTCGTGTCGACGGCCTGGGTCGCGTGCTGCCCGTTCTGCAGGCGCTCGACTACGAGGCCGACCCTCTC
ATCGACCACACCGGCGTCATCCGGGTGTTGCAGCGGGGGAGACCGGTGGCCTTGACCAGGAGCTATCCCTACCTC
CCCACCGCCGACGTCGGCCAGCCCGCGAGTGGCGGCCACGCCTCGTGCCAGCACAGGACGGCCCCGGACGCCCCC
AAGAGGCCCAGCAGGCAGCGGGCCGAGTCGGCGCCCAAGCTGTCGTCCATGTTTGTCGGCCAGGCGCGGAACAAG
GCCACGTCGGGCGACGGCGTCAAGACCATCGCGTCCCGCCTCTACGACGACGACGACCAGCCGAGACCGCCGACG
CCACGGTACGATGAGTATGAGCAGACGCCGCCGTCGCCGTGGTCTCAGTCGCCAGCGCCGTCGCCCGCGGTACGG
GCTGATCCTAAAGAGAACCCCTTCTTCACCGACGCCACCGTCGACGAGGGATGCTTTAACCCGACGTCGTCGCCC
CCTGCCAGCTACTCGGGCCTGCCGCCGCCCGAGGCCATCGGCGTCGAAAACTCGTGGACGGTGCTCCACGTCCCC
CTCAAGCACGTCCTGCTCTCGAGGCCGACGCGCCCTTTCAAGCTCGACGCCTCCGCCATGGAGCAGCGGTCTCAG
CAGACGGCCCGTCGGGACGCGGCCGACGTCGATCGCGCCTCGCCCGAGCACAAGAACGGCTCGGCCCCGATCGCC
ATCCTCTCCATCCTGAGTCCCGTCATACCCTATCCTTCCAACCTGAGGCGATCACTGGAACACCTCGCGCCGCAC
ATGGCCACGTCGTTTTCGCTGTGCCGGCACTACTCCAACCTCGAGACGGAGCTGGCCGGCATGCAGCGCAAGGGA
CCGTCGACTTCGGGCTTCGGCGCCGTGGCCCCTTATCCGCGGCACTTCGACGGCGTCCCGCTCTCGCCGCGGCCC
GACCTGGTGCGCCAGCAGTCACTGGCCGACAGCATGACGAGCCCCAGCGACTACTCGGCCATTTCGAAGAGCGCG
GCGGGATCCCCCTTGGGAACGCCCGGCTGGGATCCGGCGGCCCGCGTCACCCTGGCCGACAAGCGGCAGCCGATG
GGAAGCCCGGCCTCGGGGCCCCAGGGCGGCGAGGGTGGTGGATACTTTGGGAGTAGGCTGATGAGGTCCTCCTCG
GCAAGGTCCAAAGAGCACTCGCCGGGAGACAGGAGGCGGGAGCAGGTGACGGATCTCGACGATGTTAATGGCGGA
GACGGGCCCGACGAGTCCCCGAAGCAGAACGTGGACGCCTCCCATCACCGGGCCTCGTCGCATTCCGTTCTCCAC
AGCTACGGAGCCGACTTCGCCTCGACCTTTCAATCCCTGCCGCCGAGCTCGAGCCTCGTCAGCAGGCCGGCGGCG
CCTCGGAACGGCTCGCTGACGACGCTCGGGGCCGACATGCCGCCGCCTTCGGACCGGCTCAAGGGCCTGATCCTC
GACTCTCTGCCGGCGCACGTGTTCGTGTCGCTGCCGCGGACGGGCGAGACGGTGTGGGTGAACAGCCGGTTCCTG
TCGTACCGCGGGCAGACGGTGGCCGATCTGGCGGCGGACCCCTGGGGCAGCATCCACGCCGACGACCGCGACGGC
TACCTCAAGGCCTGGAGCCACTCGCTACGGACCGGAGAGCAGTTCTCGAGGACGGTGCGGATCAAGCGCTTCGAC
GGCGCGTACCGCTGGTTCTACGCCCGGGCGGTGGCGTCCAAGGACAAACGGGGCGTCATTATGCAGTTTCTGGGC
TCGTACATGGATATCCACGACCAGCACATCGCCGAGTTGAGGGCCGCGCGACAGGAGGAGGTGGAGGCGTCCGAG
GCGAAGCACCGGCTGCTGGCCAACCTGATACCGCAAATCATCTTTACCGCCACCGAGGACGAGGGCATCACGTTT
GCCAACGAGCAGTGGCTGTCGTACACGGGGCAGAGCTTCGACGACGCGTTGAATCTGGGCTTCATGGGGCACGTG
CATCCGGACGACCTGGCCAGGTGTCGGATCCCAACCGGACGGCGCAAGGGGCCGGCTGGCGGCAAGGCCGAGGCG
GACGGCTCCGACTCGTCGGCGTCGGGCACGATCCAGGGATGTCGGTCACCGACGGGCCGGTCGCAGCTGTCTAGG
AGCAGCAGCTCCGGGACCGAGTCGACGTCCGGGCCGGCGCCTGCGGACCTGACGGAGCTGGCGAGGCAGGGCATC
TTCAAGGTGACGACGGACACGAGCGGGAGGCTATCGTACACGACCGAGGTGCGGCTTCGGTCCAAGACGGGCGAG
TATCGCTGGCACCTGGTGCGGTGCGTGGAGATCGATACCATCGACTTTGGCCGCGGTGCCAGCTCGTACTTTGGC
TCGGCTACGGACATCAACGACCACAAGATCCTCGAGACGAAGCTGAAGGAGGCCATGGAGTCCAAGAGCCGGTTC
CTCAGCAACATGTCGCACGAGATCCGGACGCCGCTCATTGGCATCTCGGGCATGGTCAGCTTCCTGCAAGACACG
ACGCTGGACGAGGAGCAGCGCGACTACACCAACACGATCCAGACGAGCGCGAACAGCCTGATTATGATAATCAAC
GACATCCTCGACCTGTCCAAGGTAGACGCCGGCATGATGAAGCTCAAGTACGAGTGGTTCCACACGAGATCGCTC
ATCGAGGACGTCAACGAGCTGGTGTCGACCATGGCCGTGGCCAAGCGGCTCGAGCTCAACTACCTGGTGGACGCC
AACGTTCCGGCTTGGGTCAAGGGAGACAAGGTGCGGATACGCCAGGTGCTGCTCAACGTCATCGGCAACGCCATC
AAGTTTACGACCGAGGGGGAAGTGTTTAGCCGGTGCCGCGTCTTTGTCGAGGACGACGAGGCGGAAGAGGGGGAG
GATGGCAAGGACAAGCGAGACGCCAACTCGACCATGGTGCTGCAGTTCGTCATCACCGACACCGGCCGGGGCTTC
TCCCGGGAAGAGGCCGAGCTCATCTTCAAGCCCTTTAGCCAGATCGACGGCAGCAGCACGCGGCAGCACGGCGGC
AGCGGGCTGGGTCTCGTCATCTCACGGCAGCTCGTGGAGCTCCACGGAGGCCGGATGGAGGGCACGGCCGAGCCG
GGCAAGGGGTCGACGTTTACCTTTACGGCGCGGTTCGGCCTGCCGACGGCCGAGGACCATCCGCCGTCGGTATCG
CCGGCGTGGGGCGTGCCGGAGCCGACGTACGGGCTGCGGCCGGCGCAGAGGGCCGAGGCCAACGGCATCATGGTC
TCGGGCGAAGGACCGTCGCCGGGCGGTGCGTCGTCGGGCAGCTCGGATCCTTCGGTGGCTTCGGGCCGGTCGGTG
GGCGGCACGACGGACCGGTCTTCGGCTTCGTCGATGCACGTCACCAGTAGCAGCAACGCTCAGGGGCTGGCGCGC
TTCATCGAGGCGGCCAAGGCCAGCGGACATGACGTCTCGCAGATGAGGCTCGACATGGTGGACCGCAGCAGGACA
GCGACACCGGACCAGCAGCAGCCGACGCGGCCTCTCATGTACTCGATCCTGGTCATCTGTCCGCAGTATCACAGC
CGCGAGGCGACGACGCAGCACATCGAGATGACGCTGCCCAAGGAGGTCCCTCACCAGATGACGGCGCTGGCGGCC
GTCGACGAGGCGCACAAGTACATTGGCGGCGAATCGGCCATGCGGTTCACGCACATTGTGCTCAACCTGGCCTCG
GCCGAAGCCATCCTCGACGTGCTGGACCAGATCTCGCGATCGGCCAAGGCGCGGCGGACGACGGTCCTGATCCTG
ACCGACTCGGTGCAGCGGCAGGCGGTGCTCAAGCTGGCGGCGGAGACGGACCACGGCCGGCTGCTGGCGGACAAG
CTGGTGACGTTCATCTACAAGCCCGTCAAGCCCTCGAGGCTGGCCGTCATCTTCGACCCGGACAAGGTGCGCGAC
CTCAGCACGGACCGCAACCGGTCGACGGCGCAGCAGATGGTGGAGAGCCAAAAGGCCAGCTATCACGAGATTGAG
CGGCGGATGGGCAACAAGGGCTACCGCGTGCTGCTGGTCGAGGACAACCCGGTCAACCAAAAGGTGCTGACCAAG
TACCTGGGCAAGATTGGCGTCGAGGTCGACATTGCCGTTGATGGGGTTGAGTGTACGGACAAGGTGCTGTCGAAG
CCGCACCGGCACTACTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail