Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5311
Gene name
LocationContig_518:8014..8958
Strand-
Gene length (bp)944
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09749 HVSL Uncharacterised conserved protein 5.2E-83 36 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEZ0|USB1_NEUCR U6 snRNA phosphodiesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=usb1 PE=3 SV=2 34 283 6.0E-58
sp|Q5I0I5|USB1_RAT U6 snRNA phosphodiesterase OS=Rattus norvegicus GN=Usb1 PE=2 SV=1 3 279 1.0E-10
sp|Q91W78|USB1_MOUSE U6 snRNA phosphodiesterase OS=Mus musculus GN=Usb1 PE=2 SV=1 3 279 5.0E-10
sp|Q0II50|USB1_BOVIN U6 snRNA phosphodiesterase OS=Bos taurus GN=USB1 PE=2 SV=1 3 234 2.0E-09
sp|Q6DEF6|USB1_DANRE U6 snRNA phosphodiesterase OS=Danio rerio GN=usb1 PE=2 SV=1 10 279 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEZ0|USB1_NEUCR U6 snRNA phosphodiesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=usb1 PE=3 SV=2 34 283 6.0E-58
sp|Q5I0I5|USB1_RAT U6 snRNA phosphodiesterase OS=Rattus norvegicus GN=Usb1 PE=2 SV=1 3 279 1.0E-10
sp|Q91W78|USB1_MOUSE U6 snRNA phosphodiesterase OS=Mus musculus GN=Usb1 PE=2 SV=1 3 279 5.0E-10
sp|Q0II50|USB1_BOVIN U6 snRNA phosphodiesterase OS=Bos taurus GN=USB1 PE=2 SV=1 3 234 2.0E-09
sp|Q6DEF6|USB1_DANRE U6 snRNA phosphodiesterase OS=Danio rerio GN=usb1 PE=2 SV=1 10 279 2.0E-09
sp|Q9BQ65|USB1_HUMAN U6 snRNA phosphodiesterase OS=Homo sapiens GN=USB1 PE=1 SV=1 37 279 6.0E-08
sp|Q7ZYI9|USB1_XENLA U6 snRNA phosphodiesterase OS=Xenopus laevis GN=usb1 PE=2 SV=1 1 279 8.0E-08
sp|Q12208|USB1_YEAST U6 snRNA phosphodiesterase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USB1 PE=1 SV=1 62 186 1.0E-07
sp|Q9VHB3|USB1_DROME U6 snRNA phosphodiesterase OS=Drosophila melanogaster GN=CG16790 PE=2 SV=1 52 272 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004518 nuclease activity Yes
GO:0034477 U6 snRNA 3'-end processing Yes
GO:0044237 cellular metabolic process No
GO:0034472 snRNA 3'-end processing No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0016180 snRNA processing No
GO:0031123 RNA 3'-end processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016073 snRNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034470 ncRNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5311
MALVDYPSSSSSSEAGDAHAPKRLKSQQDTKALAMPPLPAAFHDLYASTVRHSVVDDPCLHQGRKRQTPHIPGCW
PSHIYIEWHPTPQQHETLSKLLSMVEAEIGRGFKLHRFLTSDLGAPLPLHISLSRPLSLRSADKDAFLDRLTQSI
QTSGLGTFPVAPCGLAWYKSPDSDRTFFILRVAAAPKLTNPQLTTLLERCNATANLYGQPTLYQKTRGEAVDMAF
HVSIAWSFGLPGDEASVETLKLFQHNDLTGLPKMRIDVTAVKAKIGNVVTHIPLAEHGNQPDGTGLALA*
Coding >Ophun1|5311
ATGGCTCTCGTCGACTATCCATCTTCCTCATCCTCTTCAGAGGCTGGAGACGCACACGCGCCCAAGCGCCTCAAG
AGTCAACAGGACACCAAGGCTCTGGCCATGCCGCCGCTTCCCGCTGCCTTTCACGATCTCTATGCCTCGACGGTC
CGCCACAGCGTCGTCGATGATCCCTGCCTGCATCAAGGCCGCAAGAGACAGACCCCTCACATTCCCGGCTGCTGG
CCGTCACACATCTACATCGAGTGGCATCCGACGCCGCAGCAGCACGAGACGCTCAGCAAGCTGCTGTCCATGGTC
GAGGCCGAGATAGGCCGCGGTTTCAAGCTCCACCGCTTCCTCACCAGCGACCTCGGCGCGCCTCTGCCCCTGCAC
ATCAGTCTTTCGCGTCCCCTGAGCCTGCGCTCCGCCGACAAGGACGCCTTCCTCGACCGACTGACGCAGTCGATC
CAGACATCCGGACTCGGCACCTTTCCCGTCGCTCCCTGCGGCCTGGCCTGGTACAAATCTCCCGACTCGGACCGA
ACGTTTTTCATCCTCCGCGTCGCGGCGGCACCCAAGTTGACGAACCCGCAGCTGACGACGCTCCTTGAGCGTTGC
AACGCCACGGCCAACTTGTACGGCCAGCCCACGCTCTACCAGAAGACGCGTGGCGAGGCCGTCGACATGGCCTTC
CACGTCTCCATCGCCTGGTCGTTTGGCCTGCCCGGCGATGAGGCGTCAGTCGAGACGCTCAAGCTCTTCCAGCAC
AACGACTTGACTGGTCTGCCCAAGATGCGCATCGACGTAACGGCAGTAAAGGCCAAGATAGGCAATGTCGTGACT
CACATTCCTCTGGCCGAACACGGGAACCAGCCTGATGGTACCGGGCTCGCTCTCGCCTGA
Transcript >Ophun1|5311
ATGGCTCTCGTCGACTATCCATCTTCCTCATCCTCTTCAGAGGCTGGAGACGCACACGCGCCCAAGCGCCTCAAG
AGTCAACAGGACACCAAGGCTCTGGCCATGCCGCCGCTTCCCGCTGCCTTTCACGATCTCTATGCCTCGACGGTC
CGCCACAGCGTCGTCGATGATCCCTGCCTGCATCAAGGCCGCAAGAGACAGACCCCTCACATTCCCGGCTGCTGG
CCGTCACACATCTACATCGAGTGGCATCCGACGCCGCAGCAGCACGAGACGCTCAGCAAGCTGCTGTCCATGGTC
GAGGCCGAGATAGGCCGCGGTTTCAAGCTCCACCGCTTCCTCACCAGCGACCTCGGCGCGCCTCTGCCCCTGCAC
ATCAGTCTTTCGCGTCCCCTGAGCCTGCGCTCCGCCGACAAGGACGCCTTCCTCGACCGACTGACGCAGTCGATC
CAGACATCCGGACTCGGCACCTTTCCCGTCGCTCCCTGCGGCCTGGCCTGGTACAAATCTCCCGACTCGGACCGA
ACGTTTTTCATCCTCCGCGTCGCGGCGGCACCCAAGTTGACGAACCCGCAGCTGACGACGCTCCTTGAGCGTTGC
AACGCCACGGCCAACTTGTACGGCCAGCCCACGCTCTACCAGAAGACGCGTGGCGAGGCCGTCGACATGGCCTTC
CACGTCTCCATCGCCTGGTCGTTTGGCCTGCCCGGCGATGAGGCGTCAGTCGAGACGCTCAAGCTCTTCCAGCAC
AACGACTTGACTGGTCTGCCCAAGATGCGCATCGACGTAACGGCAGTAAAGGCCAAGATAGGCAATGTCGTGACT
CACATTCCTCTGGCCGAACACGGGAACCAGCCTGATGGTACCGGGCTCGCTCTCGCCTGA
Gene >Ophun1|5311
ATGGCTCTCGTCGACTATCCATCTTCCTCATCCTCTTCAGAGGCTGGAGACGCACACGCGCCCAAGCGCCTCAAG
AGTCAACAGGACACCAAGGCTCTGGCCATGCCGCCGCTTCCCGCTGCCTTTCACGATCTCTATGCCTCGACGGTC
CGCCACAGCGTCGTCGATGATCCCTGCCTGCATCAAGGCCGCAAGAGACAGACCCCTCACATTCCCGGCTGCTGG
CCGTCACACATCTACATCGAGTGTGCCGTCTGCTCCGCTCCGCCTTCCAGTTCCCCTTCGGCTTCTGACGATGCT
CTACAGGGCATCCGACGCCGCAGCAGCACGAGACGCTCAGCAAGCTGCTGTCCATGGTCGAGGCCGAGATAGGCC
GCGGTTTCAAGCTCCACCGCTTCCTCACCAGCGACCTCGGCGCGCCTCTGCCCCTGCACATCAGTCTTTCGCGTC
CCCTGAGCCTGCGCTCCGCCGACAAGGACGCCTTCCTCGACCGACTGACGCAGTCGATCCAGACATCCGGACTCG
GCACCTTTCCCGTCGCTCCCTGCGGCCTGGCCTGGTACAAATCTCCCGACTCGGACCGAACGTTTTTCATCCTCC
GCGTCGCGGCGGCACCCAAGTTGACGAACCCGCAGCTGACGACGCTCCTTGAGCGTTGCAACGCCACGGCCAACT
TGTACGGCCAGCCCACGCTCTACCAGAAGACGCGTGGCGAGGCCGTCGACATGGCCTTCCACGTCTCCATCGCCT
GGTCGTTTGGCCTGCCCGGCGATGAGGCGTCAGTCGAGACGCTCAAGCTCTTCCAGCACAACGACTTGACTGGTC
TGCCCAAGATGCGCATCGACGTAACGGCAGTAAAGGCCAAGATAGGCAATGTCGTGACTCACATTCCTCTGGCCG
AACACGGGAACCAGCCTGATGGTACCGGGCTCGCTCTCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail