Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5310
Gene name
LocationContig_518:6350..6851
Strand-
Gene length (bp)501
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01111 CKS Cyclin-dependent kinase regulatory subunit 1.9E-33 30 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20486|CKS1_YEAST Cyclin-dependent kinases regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKS1 PE=1 SV=1 13 109 8.0E-47
sp|P08463|CKS1_SCHPO Cyclin-dependent kinases regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suc1 PE=1 SV=3 8 109 4.0E-44
sp|Q9SJJ5|CKS2_ARATH Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana GN=CKS2 PE=3 SV=1 27 109 2.0E-23
sp|Q91879|CKS2_XENLA Cyclin-dependent kinases regulatory subunit 2 OS=Xenopus laevis GN=cks2 PE=3 SV=1 29 106 4.0E-23
sp|Q6PS57|CKS1_ORYSJ Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica GN=CKS1 PE=2 SV=1 27 108 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20486|CKS1_YEAST Cyclin-dependent kinases regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKS1 PE=1 SV=1 13 109 8.0E-47
sp|P08463|CKS1_SCHPO Cyclin-dependent kinases regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suc1 PE=1 SV=3 8 109 4.0E-44
sp|Q9SJJ5|CKS2_ARATH Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana GN=CKS2 PE=3 SV=1 27 109 2.0E-23
sp|Q91879|CKS2_XENLA Cyclin-dependent kinases regulatory subunit 2 OS=Xenopus laevis GN=cks2 PE=3 SV=1 29 106 4.0E-23
sp|Q6PS57|CKS1_ORYSJ Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica GN=CKS1 PE=2 SV=1 27 108 5.0E-23
sp|A2XCH8|CKS1_ORYSI Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica GN=CKS1 PE=2 SV=1 27 108 5.0E-23
sp|P56390|CKS2_MOUSE Cyclin-dependent kinases regulatory subunit 2 OS=Mus musculus GN=Cks2 PE=1 SV=1 29 106 3.0E-22
sp|P33552|CKS2_HUMAN Cyclin-dependent kinases regulatory subunit 2 OS=Homo sapiens GN=CKS2 PE=1 SV=1 29 106 3.0E-22
sp|Q2KJI1|CKS2_BOVIN Cyclin-dependent kinases regulatory subunit 2 OS=Bos taurus GN=CKS2 PE=3 SV=1 29 106 3.0E-22
sp|P61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens GN=CKS1B PE=1 SV=1 30 110 1.0E-21
sp|Q0P5A5|CKS1_BOVIN Cyclin-dependent kinases regulatory subunit 1 OS=Bos taurus GN=CKS1B PE=3 SV=1 30 110 1.0E-21
sp|P61025|CKS1_MOUSE Cyclin-dependent kinases regulatory subunit 1 OS=Mus musculus GN=Cks1b PE=3 SV=1 30 110 1.0E-21
sp|O23249|CKS1_ARATH Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana GN=CKS1 PE=1 SV=1 27 106 2.0E-21
sp|Q24152|CKS1_DROME Cyclin-dependent kinases regulatory subunit OS=Drosophila melanogaster GN=Cks30A PE=3 SV=1 30 105 2.0E-20
sp|P55933|CKS1_PHYPO Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum PE=1 SV=1 28 104 4.0E-20
sp|B0G102|CKS1_DICDI Cyclin-dependent kinases regulatory subunit OS=Dictyostelium discoideum GN=cks1 PE=3 SV=1 31 105 5.0E-20
sp|Q25330|CKS1_LEIME Cyclin-dependent kinases regulatory subunit OS=Leishmania mexicana PE=3 SV=1 30 105 7.0E-20
sp|P41384|CKS1_PATVU Cyclin-dependent kinases regulatory subunit OS=Patella vulgata PE=3 SV=1 30 109 2.0E-19
sp|A8XMF2|CKS1_CAEBR Cyclin-dependent kinases regulatory subunit OS=Caenorhabditis briggsae GN=cks-1 PE=3 SV=1 28 106 4.0E-19
sp|Q17868|CKS1_CAEEL Cyclin-dependent kinases regulatory subunit OS=Caenorhabditis elegans GN=cks-1 PE=1 SV=1 28 106 7.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0019207 kinase regulator activity No
GO:0003674 molecular_function No
GO:0019887 protein kinase regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5310
MDIDSSRRNKSPRPLSDAERARLEEFIDSIHYSARYSDNLYEYRHVQLPKAMLKAIPKDYHDMSKGTLKLLWEDE
WRALGITQSLGWEHYEVHEPEPHILLFKRPLNYQPPQ*
Coding >Ophun1|5310
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGGGCTCGACTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTACTCTGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAG
GCCATGCTCAAGGCCATCCCCAAAGACTACCACGATATGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAG
TGGCGGGCTCTCGGAATCACTCAGAGCTTGGGCTGGGAGCATTATGAAGTCCACGAGCCGGAACCGCACATTCTC
CTCTTCAAGCGTCCGCTCAACTACCAGCCACCGCAGTAA
Transcript >Ophun1|5310
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGGGCTCGACTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTACTCTGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAG
GCCATGCTCAAGGCCATCCCCAAAGACTACCACGATATGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAG
TGGCGGGCTCTCGGAATCACTCAGAGCTTGGGCTGGGAGCATTATGAAGTCCACGAGCCGGAACCGCACATTCTC
CTCTTCAAGCGTCCGCTCAACTACCAGCCACCGCAGTAA
Gene >Ophun1|5310
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGGGCTCGACTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTAGGCTTGCTCGCCGTCGCCGTCTCGATCCGAAGCTGACGTCGTC
TATCTAGGTACTCTGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAGGCCATGCTCAAGGCCATCCCCA
AAGACTACCACGATATGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAGTGGCGGGCTCTCGGAATCACTC
AGGTGCGTACAGACGTGGGTACACGATCTGGACGTCGCTGACTCGACGCAGAGCTTGGGCTGGGAGCATTATGAA
GTCCACGAGCCGGAACCGCACATTCTCCTCTTCAAGTTGGTGCCCCCCCCCCCCTCCCTCGTCCGTCGCGGTATC
TGACTCGCACGCATCGATAGGCGTCCGCTCAACTACCAGCCACCGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail