Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5303
Gene name
LocationContig_516:3037..3503
Strand+
Gene length (bp)466
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999765

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6581
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03780
Ophiocordyceps camponoti-rufipedis Ophun1|5303 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3002

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5303
MFKAAVILALCSTALTSALHGRDSHCGGDNCARQVTGTRSGLVPIETRRADCSSFMAAMPETITTTVTVTDGGYG
YYPPYADPKAASDVPTAADDADEDGRGLDVQAMSLLVRPG*
Coding >Ophun1|5303
ATGTTCAAGGCCGCCGTCATCCTCGCCCTCTGCTCCACCGCTCTGACCAGCGCTCTCCACGGCCGCGACAGCCAC
TGCGGAGGCGACAATTGCGCACGACAGGTGACGGGCACGCGATCCGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTCATGGCAGCAATGCCAGAGACCATCACCACCACTGTCACCGTCACCGACGGCGGCTACGGC
TACTATCCCCCTTACGCCGACCCCAAGGCAGCCAGCGACGTGCCAACCGCCGCGGACGACGCAGACGAAGACGGT
CGCGGTCTCGACGTCCAGGCCATGTCCCTACTCGTGAGACCGGGATAG
Transcript >Ophun1|5303
ATGTTCAAGGCCGCCGTCATCCTCGCCCTCTGCTCCACCGCTCTGACCAGCGCTCTCCACGGCCGCGACAGCCAC
TGCGGAGGCGACAATTGCGCACGACAGGTGACGGGCACGCGATCCGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTCATGGCAGCAATGCCAGAGACCATCACCACCACTGTCACCGTCACCGACGGCGGCTACGGC
TACTATCCCCCTTACGCCGACCCCAAGGCAGCCAGCGACGTGCCAACCGCCGCGGACGACGCAGACGAAGACGGT
CGCGGTCTCGACGTCCAGGCCATGTCCCTACTCGTGAGACCGGGATAG
Gene >Ophun1|5303
ATGTTCAAGGCCGCCGTCATCCTCGCCCTCTGCTCCACCGCTCTGACCAGCGCTCTCCACGGCCGCGACAGCCAC
TGCGGAGGCGACAATTGCGCACGACAGGTGACGGGCACGCGATCCGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTCATGGCAGCAATGCCAGAGACCATGTACGTCTTCTTTCACGGTACAAGCATCCGTCAAGGG
ACTTAGACGTCGGCAGCACCACCACTGTCACCGTCACCGACGGCGGCTACGGCTACTATCCCCCTTACGCCGACC
CCAAGGCAGCCAGCGACGTGCCAACGTACGCTCCAGCCTGCCGGGCAGCGAGCAGATACTCATCCGCGTGTTCGT
GCTGGGGCATCACAGCGCCGCGGACGACGCAGACGAAGACGGTCGCGGTCTCGACGTCCAGGCCATGTCCCTACT
CGTGAGACCGGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail