Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5302
Gene name
LocationContig_516:1102..2405
Strand+
Gene length (bp)1303
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 243 265 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5302
MRPSIHCLFLLLSTTSALDSRDGIHRIQKKAPTTREARLHARDDANTCGGGLKMCPSSLGGRCCPDNYDCARESC
YATTRGQSTCGSKVGWYACAAVYGGGCCPDGYLCQRAANCVPPSGSPYTYGCPTSQHLCPSSMSYGCCPNGMACA
VGQCYSTALTTTMRYLAMTSVLSNGRTTEMTSTVMATVRPEAPTGFPSAADPEAGGDGDQNVHKYYPTAIAQVSP
PQPVGQGTAEGAISGAQVAGLVAGSMSLLGLVCVVVYMLLRRFMPKFGSRNRDSIMVAVGKPASSDEFAHPPPAS
DTDGPCCPELPSPCPEDDGGAGRTPTMAMITPTISQLSRDDSFYPRPSDVSEASSDVRAELEAQSPPSELPGSPS
SAGDGGWSASTPHSFRWTDGWYTSRRLDVVDEETHG*
Coding >Ophun1|5302
ATGAGGCCCTCCATCCACTGCCTCTTTCTCCTCCTCTCCACGACTTCAGCCCTCGACAGCCGTGATGGCATCCAC
CGGATCCAGAAGAAGGCCCCGACAACACGTGAGGCTCGCCTCCACGCCCGAGACGACGCAAACACGTGCGGAGGC
GGGCTGAAGATGTGTCCCAGCAGCCTCGGCGGCCGATGCTGTCCAGATAACTACGACTGCGCGCGTGAGAGCTGC
TATGCCACTACCAGGGGCCAGTCTACGTGCGGTAGCAAGGTCGGCTGGTACGCCTGCGCGGCTGTATACGGAGGC
GGTTGTTGTCCGGATGGCTATCTATGCCAGAGAGCGGCCAACTGCGTGCCTCCGTCTGGGTCGCCTTACACCTAC
GGCTGCCCGACGAGCCAGCATCTTTGCCCGTCGTCGATGAGCTACGGCTGCTGTCCAAACGGCATGGCCTGTGCC
GTCGGTCAGTGCTACTCTACGGCTCTCACGACGACGATGCGTTATCTCGCCATGACCTCGGTCCTCTCCAATGGC
CGTACCACCGAGATGACGTCGACGGTCATGGCCACGGTCCGGCCCGAGGCCCCGACCGGCTTTCCCTCGGCCGCC
GATCCGGAAGCCGGGGGAGATGGCGATCAGAACGTTCACAAGTACTATCCCACGGCCATCGCTCAGGTATCGCCG
CCGCAGCCGGTCGGACAGGGCACCGCAGAAGGGGCCATCTCAGGGGCTCAGGTGGCCGGGCTCGTGGCCGGTTCC
ATGTCCCTTCTTGGCCTCGTCTGTGTAGTCGTTTACATGCTTCTACGGCGATTCATGCCGAAATTCGGCAGCAGG
AACAGAGACTCCATCATGGTGGCCGTTGGCAAGCCGGCTTCTTCCGATGAATTCGCTCACCCTCCCCCGGCATCA
GACACGGACGGGCCCTGCTGCCCTGAACTCCCCTCGCCATGCCCAGAAGACGATGGCGGAGCTGGCAGGACGCCG
ACCATGGCGATGATTACGCCCACTATTAGCCAACTGAGCCGCGATGACTCGTTCTACCCGCGGCCGAGTGATGTT
TCCGAGGCGTCCAGCGACGTCCGCGCCGAGCTCGAAGCCCAGTCCCCACCATCCGAGCTCCCCGGCTCACCATCA
TCTGCCGGGGATGGAGGCTGGTCTGCTTCGACGCCGCACTCGTTCCGCTGGACGGACGGCTGGTATACGTCTCGC
AGGCTGGACGTGGTGGATGAGGAGACGCATGGGTGA
Transcript >Ophun1|5302
ATGAGGCCCTCCATCCACTGCCTCTTTCTCCTCCTCTCCACGACTTCAGCCCTCGACAGCCGTGATGGCATCCAC
CGGATCCAGAAGAAGGCCCCGACAACACGTGAGGCTCGCCTCCACGCCCGAGACGACGCAAACACGTGCGGAGGC
GGGCTGAAGATGTGTCCCAGCAGCCTCGGCGGCCGATGCTGTCCAGATAACTACGACTGCGCGCGTGAGAGCTGC
TATGCCACTACCAGGGGCCAGTCTACGTGCGGTAGCAAGGTCGGCTGGTACGCCTGCGCGGCTGTATACGGAGGC
GGTTGTTGTCCGGATGGCTATCTATGCCAGAGAGCGGCCAACTGCGTGCCTCCGTCTGGGTCGCCTTACACCTAC
GGCTGCCCGACGAGCCAGCATCTTTGCCCGTCGTCGATGAGCTACGGCTGCTGTCCAAACGGCATGGCCTGTGCC
GTCGGTCAGTGCTACTCTACGGCTCTCACGACGACGATGCGTTATCTCGCCATGACCTCGGTCCTCTCCAATGGC
CGTACCACCGAGATGACGTCGACGGTCATGGCCACGGTCCGGCCCGAGGCCCCGACCGGCTTTCCCTCGGCCGCC
GATCCGGAAGCCGGGGGAGATGGCGATCAGAACGTTCACAAGTACTATCCCACGGCCATCGCTCAGGTATCGCCG
CCGCAGCCGGTCGGACAGGGCACCGCAGAAGGGGCCATCTCAGGGGCTCAGGTGGCCGGGCTCGTGGCCGGTTCC
ATGTCCCTTCTTGGCCTCGTCTGTGTAGTCGTTTACATGCTTCTACGGCGATTCATGCCGAAATTCGGCAGCAGG
AACAGAGACTCCATCATGGTGGCCGTTGGCAAGCCGGCTTCTTCCGATGAATTCGCTCACCCTCCCCCGGCATCA
GACACGGACGGGCCCTGCTGCCCTGAACTCCCCTCGCCATGCCCAGAAGACGATGGCGGAGCTGGCAGGACGCCG
ACCATGGCGATGATTACGCCCACTATTAGCCAACTGAGCCGCGATGACTCGTTCTACCCGCGGCCGAGTGATGTT
TCCGAGGCGTCCAGCGACGTCCGCGCCGAGCTCGAAGCCCAGTCCCCACCATCCGAGCTCCCCGGCTCACCATCA
TCTGCCGGGGATGGAGGCTGGTCTGCTTCGACGCCGCACTCGTTCCGCTGGACGGACGGCTGGTATACGTCTCGC
AGGCTGGACGTGGTGGATGAGGAGACGCATGGGTGA
Gene >Ophun1|5302
ATGAGGCCCTCCATCCACTGCCTCTTTCTCCTCCTCTCCACGACTTCAGCCCTCGACAGCCGTGATGGCATCCAC
CGGATCCAGAAGAAGGCCCCGACAACACGTGAGGCTCGCCTCCACGCCCGAGACGACGCAAACACGTGCGGAGGC
GGGCTGAAGATGTGTCCCAGCAGCCTCGGCGGCCGATGCTGTCCAGATAACTACGACTGCGCGCGTGAGAGCTGC
TATGCCACTACCAGGGGCCAGTCTACGTGCGGTAGCAAGGTCGGCTGGTACGCCTGCGCGGCTGTATACGGAGGT
GAGGGCGCTGAAGCATCTATATCGAGTCCCAAAGGGTCGCTGACGACGTCTGTTTCATGGTAAAGGCGGTTGTTG
TCCGGATGGCTATCTATGCCAGAGAGCGGCCAACTGCGTGCCTCCGTCTGGGTCGCCTTACACCTACGGCTGCCC
GACGAGCCAGCATCTTTGCCCGTCGTCGATGAGCTACGGCTGCTGTCCAAACGGCATGGCCTGTGCCGTCGGTCA
GTGCTACTCTACGGCTCTCACGACGACGATGCGTTATCTCGCCATGACCTCGGTCCTCTCCAATGGCCGTACCAC
CGAGATGACGTCGACGGTCATGGCCACGGTCCGGCCCGAGGCCCCGACCGGCTTTCCCTCGGCCGCCGATCCGGA
AGCCGGGGGAGATGGCGATCAGAACGTTCACAAGTACTATCCCACGGCCATCGCTCAGGTATCGCCGCCGCAGCC
GGTCGGACAGGGCACCGCAGAAGGGGCCATCTCAGGGGCTCAGGTGGCCGGGCTCGTGGCCGGTTCCATGTCCCT
TCTTGGCCTCGTCTGTGTAGTCGTTTACATGCTTCTACGGCGATTCATGCCGAAATTCGGCAGCAGGAACAGAGA
CTCCATCATGGTGGCCGTTGGCAAGCCGGCTTCTTCCGATGAATTCGCTCACCCTCCCCCGGCATCAGACACGGA
CGGGCCCTGCTGCCCTGAACTCCCCTCGCCATGCCCAGAAGACGATGGCGGAGCTGGCAGGACGCCGACCATGGC
GATGATTACGCCCACTATTAGCCAACTGAGCCGCGATGACTCGTTCTACCCGCGGCCGAGTGATGTTTCCGAGGC
GTCCAGCGACGTCCGCGCCGAGCTCGAAGCCCAGTCCCCACCATCCGAGCTCCCCGGCTCACCATCATCTGCCGG
GGATGGAGGCTGGTCTGCTTCGACGCCGCACTCGTTCCGCTGGACGGACGGCTGGTATACGTCTCGCAGGCTGGA
CGTGGTGGATGAGGAGACGCATGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail