Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5295
Gene name
LocationContig_514:350..1709
Strand+
Gene length (bp)1359
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 8.1E-22 145 263
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-13 165 254
PF13649 Methyltransf_25 Methyltransferase domain 4.6E-13 165 252
PF08242 Methyltransf_12 Methyltransferase domain 3.5E-09 165 254

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 162 265 2.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 162 269 3.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 162 269 5.0E-09

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5295
MDDQEVQRDTLQRDAAQPDDTQQTLDNNSKKPDSDDTRLASPLTHPNGTSIFPTLSASEQHLIAQEALEQAQAAI
LLDEQVVRDESDAGYSSDGFSSATTSAQSSVRDYLYENGRRYHRFREGSYNFPNDDVEQEREDMKHAMVKLLCSQ
KLLFAPIGHNPQQMLDLGTGTGIWAIEVGDQYPSAHVLGVDLSPIQPDWLPPNVRFLVDDVESTWLYPPNHFDYI
HSRHTVMAVRDWRRLFRQAYQHLKPGGWIELQEIHHKPRSARPDGRPLSPDHAVAQFWARVNEGLTGLGVDLDRA
AGGFLAQAMRDEGLVNLTERVFHVPIGTWPKNKVLKTVGLYWRTILLDGLQAIALGPLTRGLQWDRQQVELFLVD
VRRAYHDNSALMYMPLHILYAQKPE*
Coding >Ophun1|5295
ATGGACGATCAAGAGGTTCAGCGGGACACTCTCCAGCGAGATGCCGCCCAACCAGACGATACCCAGCAGACCCTC
GACAACAACAGCAAGAAGCCCGACTCCGACGACACTCGCCTCGCCTCGCCACTGACGCACCCAAACGGCACCTCC
ATCTTCCCCACGCTCTCCGCCTCGGAGCAGCACCTCATAGCCCAAGAGGCCCTCGAGCAGGCCCAGGCGGCCATC
CTCCTCGACGAGCAGGTGGTGCGCGATGAGTCTGACGCCGGCTACAGCAGCGACGGCTTCAGCTCTGCCACTACG
TCGGCCCAGTCCTCGGTGCGGGATTACCTGTACGAGAACGGCCGGCGATATCACCGCTTCCGCGAGGGTTCCTAC
AACTTTCCCAACGACGACGTCGAGCAAGAGCGCGAGGACATGAAGCACGCCATGGTCAAGCTCCTCTGCTCGCAG
AAGCTCCTCTTCGCCCCCATCGGCCACAATCCGCAGCAGATGCTCGATCTCGGCACCGGCACCGGCATATGGGCC
ATCGAGGTGGGAGATCAGTATCCGAGCGCCCACGTGCTGGGCGTCGATCTGTCTCCCATTCAGCCCGACTGGCTG
CCGCCCAACGTGCGCTTCCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCATTTTGACTATATT
CATTCGCGTCATACCGTCATGGCTGTACGTGACTGGCGCCGACTCTTCCGCCAGGCCTACCAGCACCTCAAGCCC
GGAGGCTGGATCGAGCTCCAAGAGATCCACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGGCCCCTCTCTCCA
GATCACGCCGTGGCCCAGTTCTGGGCCCGCGTCAACGAAGGCCTCACGGGGCTCGGCGTCGACCTCGACCGCGCG
GCCGGAGGCTTCCTGGCACAGGCCATGCGCGATGAAGGCCTCGTCAACCTCACCGAGCGCGTCTTTCACGTCCCG
ATCGGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTGTACTGGCGCACCATTCTGCTAGACGGTCTG
CAGGCCATTGCCCTCGGGCCCCTGACCCGTGGCCTCCAATGGGACCGGCAACAGGTCGAGCTGTTCCTCGTCGAC
GTCCGCCGCGCCTATCACGACAACTCGGCCCTTATGTACATGCCTCTGCATATCCTCTACGCTCAGAAGCCCGAA
TGA
Transcript >Ophun1|5295
ATGGACGATCAAGAGGTTCAGCGGGACACTCTCCAGCGAGATGCCGCCCAACCAGACGATACCCAGCAGACCCTC
GACAACAACAGCAAGAAGCCCGACTCCGACGACACTCGCCTCGCCTCGCCACTGACGCACCCAAACGGCACCTCC
ATCTTCCCCACGCTCTCCGCCTCGGAGCAGCACCTCATAGCCCAAGAGGCCCTCGAGCAGGCCCAGGCGGCCATC
CTCCTCGACGAGCAGGTGGTGCGCGATGAGTCTGACGCCGGCTACAGCAGCGACGGCTTCAGCTCTGCCACTACG
TCGGCCCAGTCCTCGGTGCGGGATTACCTGTACGAGAACGGCCGGCGATATCACCGCTTCCGCGAGGGTTCCTAC
AACTTTCCCAACGACGACGTCGAGCAAGAGCGCGAGGACATGAAGCACGCCATGGTCAAGCTCCTCTGCTCGCAG
AAGCTCCTCTTCGCCCCCATCGGCCACAATCCGCAGCAGATGCTCGATCTCGGCACCGGCACCGGCATATGGGCC
ATCGAGGTGGGAGATCAGTATCCGAGCGCCCACGTGCTGGGCGTCGATCTGTCTCCCATTCAGCCCGACTGGCTG
CCGCCCAACGTGCGCTTCCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCATTTTGACTATATT
CATTCGCGTCATACCGTCATGGCTGTACGTGACTGGCGCCGACTCTTCCGCCAGGCCTACCAGCACCTCAAGCCC
GGAGGCTGGATCGAGCTCCAAGAGATCCACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGGCCCCTCTCTCCA
GATCACGCCGTGGCCCAGTTCTGGGCCCGCGTCAACGAAGGCCTCACGGGGCTCGGCGTCGACCTCGACCGCGCG
GCCGGAGGCTTCCTGGCACAGGCCATGCGCGATGAAGGCCTCGTCAACCTCACCGAGCGCGTCTTTCACGTCCCG
ATCGGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTGTACTGGCGCACCATTCTGCTAGACGGTCTG
CAGGCCATTGCCCTCGGGCCCCTGACCCGTGGCCTCCAATGGGACCGGCAACAGGTCGAGCTGTTCCTCGTCGAC
GTCCGCCGCGCCTATCACGACAACTCGGCCCTTATGTACATGCCTCTGCATATCCTCTACGCTCAGAAGCCCGAA
TGA
Gene >Ophun1|5295
ATGGACGATCAAGAGGTTCAGCGGGACACTCTCCAGCGAGATGCCGCCCAACCAGACGATACCCAGCAGACCCTC
GACAACAACAGCAAGAAGCCCGACTCCGACGACACTCGCCTCGCCTCGCCACTGACGCACCCAAACGGCACCTCC
ATCTTCCCCACGCTCTCCGCCTCGGAGCAGCACCTCATAGCCCAAGAGGCCCTCGAGCAGGCCCAGGCGGCCATC
CTCCTCGACGAGCAGGTGGTGCGCGATGAGTCTGACGCCGGCTACAGCAGCGACGGCTTCAGCTCTGCCACTACG
TCGGCCCAGTCCTCGGTGCGGGATTACCTGTACGAGAACGGCCGGCGATATCACCGCTTCCGCGAGGGTTCCTAC
AACTTTCCCAACGACGACGTCGAGCAAGAGGTCCGTGTCTTGTCCGTCCTTGCCTTTTCCCCCCCTCTCCGCGGC
TGATATCCAGGGAAGCGCGAGGACATGAAGCACGCCATGGTCAAGCTCCTCTGCTCGCAGAAGCTCCTCTTCGCC
CCCATCGGCCACAATCCGCAGCAGATGCTCGATCTCGGCACCGGCACCGGCATATGGGCCATCGAGGTGGGAGAT
CAGTATCCGAGCGCCCACGTGCTGGGCGTCGATCTGTCTCCCATTCAGCCCGACTGGCTGCCGCCCAACGTGCGC
TTCCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCATTTTGACTATATTCATTCGCGTCATACC
GTCATGGCTGTACGTGACTGGCGCCGACTCTTCCGCCAGGCCTACCAGTAGGTCGTCCAGAGAGCGAGAGAGCGA
GAGGGGAGAGGCAGATGGAGCAAACAAACAAGGCCCTAAGAGAACTGAAACGTCCATCTTCTGCCCAGGCACCTC
AAGCCCGGAGGCTGGATCGAGCTCCAAGAGATCCACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGGCCCCTC
TCTCCAGATCACGCCGTGGCCCAGTTCTGGGCCCGCGTCAACGAAGGCCTCACGGGGCTCGGCGTCGACCTCGAC
CGCGCGGCCGGAGGCTTCCTGGCACAGGCCATGCGCGATGAAGGCCTCGTCAACCTCACCGAGCGCGTCTTTCAC
GTCCCGATCGGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTGTACTGGCGCACCATTCTGCTAGAC
GGTCTGCAGGCCATTGCCCTCGGGCCCCTGACCCGTGGCCTCCAATGGGACCGGCAACAGGTCGAGCTGTTCCTC
GTCGACGTCCGCCGCGCCTATCACGACAACTCGGCCCTTATGTACATGCCTCTGCATATCCTCTACGCTCAGAAG
CCCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail