Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5283
Gene name
LocationContig_511:10017..10960
Strand+
Gene length (bp)943
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 4.1E-09 55 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B5D4|SOD5_ARTBC Cell surface Cu-only superoxide dismutase ARB_03674 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03674 PE=1 SV=1 1 187 5.0E-39
sp|Q5ACV9|SOD6_CANAL Cell surface superoxide dismutase [Cu-Zn] 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD6 PE=1 SV=1 15 185 5.0E-28
sp|Q5AD07|SOD5_CANAL Cell surface Cu-only superoxide dismutase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD5 PE=1 SV=1 53 254 4.0E-24
sp|Q5AD05|SOD4_CANAL Cell surface superoxide dismutase [Cu-Zn] 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD4 PE=1 SV=1 31 187 8.0E-22

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006801 superoxide metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0072593 reactive oxygen species metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999667

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1511
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|212
Ophiocordyceps australis map64 (Brazil) OphauB2|3176
Ophiocordyceps camponoti-floridani Ophcf2|00381
Ophiocordyceps camponoti-rufipedis Ophun1|5283 (this protein)
Ophiocordyceps kimflemingae Ophio5|2757
Ophiocordyceps subramaniannii Hirsu2|11169

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5283
MRAALLATASLSAGLVAAQGTQSAPVIKGNPSSASFEAKLPAEAFTAGSLNGNIKGSIKASTPADGVGVEFKVQF
ENLPKEGGPFVYHIHEEPVPADGNCTKTLTHLDPYKRGEDPPCEKSRPETCQVGDLSGKHGKPNSNTTTFIATYV
DPFLSTSPESNAFFGNRSFVIHFANKTRITCANFESIGAAAPVGPSTGGGESSANSTSAGSQAAAASTSTGSQVA
AASTSTGGQTSSSTTMASTQPSSSGSSAASTGSSSSANNPSVTSGGDAALSTLSMSLTMLSMAAAFALVF*
Coding >Ophun1|5283
ATGCGTGCCGCTCTCTTGGCCACCGCCTCCCTCTCGGCTGGCCTCGTCGCCGCCCAGGGCACCCAGTCCGCGCCC
GTCATCAAGGGCAACCCTTCCAGCGCCAGCTTTGAGGCGAAGCTGCCTGCTGAGGCCTTTACCGCTGGCTCGCTC
AACGGAAACATCAAGGGTTCCATCAAGGCCAGCACGCCCGCTGATGGTGTGGGCGTCGAGTTCAAGGTTCAGTTT
GAGAACCTTCCCAAGGAGGGCGGGCCCTTCGTCTACCACATCCACGAAGAGCCCGTCCCGGCTGACGGCAACTGC
ACCAAGACGCTCACCCACCTGGATCCTTATAAGCGTGGCGAAGATCCTCCCTGCGAAAAGTCCCGTCCCGAGACG
TGCCAGGTTGGCGACTTGAGCGGCAAGCACGGCAAGCCCAACTCCAACACTACCACTTTCATCGCCACCTACGTC
GATCCCTTCCTGTCGACGAGCCCGGAGTCCAACGCCTTCTTCGGCAACCGCTCCTTTGTCATCCACTTCGCCAAC
AAGACGCGCATCACCTGCGCCAACTTCGAGTCCATTGGTGCCGCTGCTCCCGTCGGCCCCTCGACCGGCGGAGGC
GAGAGCTCTGCCAACTCGACTTCGGCGGGAAGCCAAGCCGCTGCCGCCTCGACTTCGACGGGAAGCCAAGTCGCT
GCCGCCTCGACCTCGACGGGAGGCCAAACCTCTTCTTCGACTACGATGGCTTCTACCCAGCCCAGCAGTTCTGGC
TCCTCAGCCGCCAGTACTGGCTCCTCATCCAGCGCCAACAACCCGTCCGTGACTTCTGGCGGCGATGCTGCCCTT
TCAACTCTTTCCATGTCGCTTACGATGCTTTCCATGGCGGCCGCCTTTGCCTTGGTGTTTTAG
Transcript >Ophun1|5283
ATGCGTGCCGCTCTCTTGGCCACCGCCTCCCTCTCGGCTGGCCTCGTCGCCGCCCAGGGCACCCAGTCCGCGCCC
GTCATCAAGGGCAACCCTTCCAGCGCCAGCTTTGAGGCGAAGCTGCCTGCTGAGGCCTTTACCGCTGGCTCGCTC
AACGGAAACATCAAGGGTTCCATCAAGGCCAGCACGCCCGCTGATGGTGTGGGCGTCGAGTTCAAGGTTCAGTTT
GAGAACCTTCCCAAGGAGGGCGGGCCCTTCGTCTACCACATCCACGAAGAGCCCGTCCCGGCTGACGGCAACTGC
ACCAAGACGCTCACCCACCTGGATCCTTATAAGCGTGGCGAAGATCCTCCCTGCGAAAAGTCCCGTCCCGAGACG
TGCCAGGTTGGCGACTTGAGCGGCAAGCACGGCAAGCCCAACTCCAACACTACCACTTTCATCGCCACCTACGTC
GATCCCTTCCTGTCGACGAGCCCGGAGTCCAACGCCTTCTTCGGCAACCGCTCCTTTGTCATCCACTTCGCCAAC
AAGACGCGCATCACCTGCGCCAACTTCGAGTCCATTGGTGCCGCTGCTCCCGTCGGCCCCTCGACCGGCGGAGGC
GAGAGCTCTGCCAACTCGACTTCGGCGGGAAGCCAAGCCGCTGCCGCCTCGACTTCGACGGGAAGCCAAGTCGCT
GCCGCCTCGACCTCGACGGGAGGCCAAACCTCTTCTTCGACTACGATGGCTTCTACCCAGCCCAGCAGTTCTGGC
TCCTCAGCCGCCAGTACTGGCTCCTCATCCAGCGCCAACAACCCGTCCGTGACTTCTGGCGGCGATGCTGCCCTT
TCAACTCTTTCCATGTCGCTTACGATGCTTTCCATGGCGGCCGCCTTTGCCTTGGTGTTTTAG
Gene >Ophun1|5283
ATGCGTGCCGCTCTCTTGGCCACCGCCTCCCTCTCGGCTGGCCTCGTCGCCGCCCAGGGCACCCAGTCCGCGCCC
GTCATCAAGGGCAACCCTTCCAGCGCCAGCTTTGAGGCGAAGCTGCCTGCTGAGGCCTTTACCGCTGGCTCGCTC
AACGGAAACATCAAGGGTTCCATCAAGGCCAGCACGCCCGCTGATGGTGTGGGCGTCGAGTTCAAGGTTCAGTTT
GAGAACCTTCCCAAGGAGGGCGGGCCCTTCGGTGAGTCGCAGTCCCTTTTTCCATCTCTCATCCACTTGAGCTGA
CCGTTACCCAGTCTACCACATCCACGAAGAGCCCGTCCCGGCTGACGGCAACTGCACCAAGACGCTCACCCACCT
GGATCCTTATAAGCGTGGCGAAGATCCTCCCTGCGAAAAGTCCCGTCCCGAGACGTGCCAGGTTGGCGACTTGAG
CGGCAAGCACGGCAAGCCCAACTCCAACACTACCACTTTCATCGCCACCTACGTCGATCCCTTCCTGTCGACGAG
CCCGGAGTCCAACGCCTTCTTCGGCAACCGCTCCTTTGTCATCCACTTCGCCAACAAGACGCGCATCACCTGCGC
CAACTTCGAGTCCATTGGTGCCGCTGCTCCCGTCGGCCCCTCGACCGGCGGAGGCGAGAGCTCTGCCAACTCGAC
TTCGGCGGGAAGCCAAGCCGCTGCCGCCTCGACTTCGACGGGAAGCCAAGTCGCTGCCGCCTCGACCTCGACGGG
AGGCCAAACCTCTTCTTCGACTACGATGGCTTCTACCCAGCCCAGCAGTTCTGGCTCCTCAGCCGCCAGTACTGG
CTCCTCATCCAGCGCCAACAACCCGTCCGTGACTTCTGGCGGCGATGCTGCCCTTTCAACTCTTTCCATGTCGCT
TACGATGCTTTCCATGGCGGCCGCCTTTGCCTTGGTGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail