Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5277
Gene name
LocationContig_510:7293..9083
Strand+
Gene length (bp)1790
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.7E-16 197 398
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-09 174 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 169 398 2.0E-07
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 172 398 2.0E-07
sp|Q9VT57|CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster GN=Cdk8 PE=1 SV=2 289 398 3.0E-07
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 315 397 3.0E-07
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 315 398 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 169 398 2.0E-07
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 172 398 2.0E-07
sp|Q9VT57|CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster GN=Cdk8 PE=1 SV=2 289 398 3.0E-07
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 315 397 3.0E-07
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 315 398 4.0E-07
sp|P49336|CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens GN=CDK8 PE=1 SV=1 289 398 4.0E-07
sp|Q6P3N6|CDK8_XENTR Cyclin-dependent kinase 8 OS=Xenopus tropicalis GN=cdk8 PE=2 SV=1 289 398 4.0E-07
sp|Q8R3L8|CDK8_MOUSE Cyclin-dependent kinase 8 OS=Mus musculus GN=Cdk8 PE=2 SV=3 289 398 4.0E-07
sp|Q8JH47|CDK8_DANRE Cyclin-dependent kinase 8 OS=Danio rerio GN=cdk8 PE=2 SV=1 289 398 5.0E-07
sp|Q54RB2|CDK11_DICDI Cyclin-dependent kinase 11 OS=Dictyostelium discoideum GN=cdk11 PE=3 SV=1 293 398 5.0E-07
sp|Q8BWD8|CDK19_MOUSE Cyclin-dependent kinase 19 OS=Mus musculus GN=Cdk19 PE=2 SV=1 315 398 7.0E-07
sp|Q9BWU1|CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens GN=CDK19 PE=1 SV=1 315 398 8.0E-07
sp|P0C661|CDK8_CAEBR Cyclin-dependent kinase 8 OS=Caenorhabditis briggsae GN=cdk-8 PE=3 SV=2 315 398 1.0E-06
sp|Q17IE8|CDK8_AEDAE Cyclin-dependent kinase 8 OS=Aedes aegypti GN=Cdk8 PE=3 SV=2 315 398 2.0E-06
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 165 398 2.0E-06
sp|P90866|CDK8_CAEEL Cyclin-dependent kinase 8 OS=Caenorhabditis elegans GN=cdk-8 PE=3 SV=4 315 398 2.0E-06
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 171 398 3.0E-06
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 171 398 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5277
MSLRSRLRLTAQCNGRHFFYPAGEIRSIFQTEAIEIELAAVFPDWTPAKVTARAELACSDGMDGPESITRLFVIL
VLIHRLQDLESFIDEKIKDCHLPLWLGRGGSGLFLGPNDTGPVGSCHRWELDSIDDFNYVQKKVLAPCFQDKAAG
AVTSQLIKPDVFMPWTEKEPVAEILHGNYSSVYAVKIHKDHHQFRVNGERCDKFALKVLKTRIRDQFLKELRCLN
LCADRDNLVELYSAYEQGGIYSFLFPWAHGGSLLTLWDLDPETWSQSNVVNSVRWIAHQCYKLASKTGLGHIHDG
RGIESTSTFDKLYGIHGDIKPANILLYRDQETVHGPGVLKISDMGFTDFHSVQSRSMQPPLRPHSPAYRAPEHGM
KTIFLSRKYDIWGLGCVFSELLSWFIRGPNGVKNYSWKRRNDKYDDDRWGGDDFFRHFYNEDNLVVHADLKPSVI
RWINELCNIVGTTNFLSDFLNYIKDRMLVVDCDQRATCDEVSDFLRQLYNHCLVNEQYCTSHLPFHMEDLEEQEE
QQKREQQVRLKRGASDFGTNSHDPRFKRARYFRG*
Coding >Ophun1|5277
ATGAGCCTTCGATCGCGATTACGGTTGACGGCCCAGTGCAACGGTCGCCACTTCTTCTATCCAGCCGGAGAGATC
CGGTCCATCTTCCAGACTGAGGCCATCGAGATCGAGTTGGCGGCCGTCTTTCCGGACTGGACCCCGGCCAAGGTG
ACGGCCCGCGCCGAACTAGCCTGCAGCGACGGCATGGACGGGCCGGAGTCCATCACGAGGCTTTTTGTCATCCTG
GTGCTCATCCACCGGTTGCAAGACCTTGAGTCTTTCATTGACGAGAAGATCAAGGACTGTCATTTGCCGCTGTGG
CTCGGGAGAGGAGGCAGCGGGCTGTTCCTCGGCCCCAACGATACCGGCCCGGTTGGATCCTGCCACAGATGGGAG
CTGGACTCGATCGACGACTTTAATTACGTCCAAAAAAAGGTCCTCGCTCCTTGCTTCCAGGATAAGGCCGCCGGG
GCTGTCACCTCCCAGCTCATCAAGCCGGATGTTTTCATGCCCTGGACCGAGAAAGAGCCCGTCGCAGAAATCCTG
CACGGCAACTACTCGAGCGTTTACGCCGTCAAGATTCACAAGGATCATCACCAGTTTAGGGTGAATGGGGAGCGG
TGTGACAAGTTTGCGCTCAAAGTTCTCAAGACACGGATTAGAGACCAGTTTTTGAAGGAGCTCAGATGCCTCAAC
TTGTGCGCGGACAGGGACAACCTGGTCGAGCTGTACAGCGCCTACGAGCAAGGCGGCATCTACTCATTCCTCTTC
CCCTGGGCTCATGGCGGCTCTCTCCTGACGCTCTGGGATTTGGATCCAGAGACCTGGAGCCAGTCGAACGTGGTC
AACTCTGTGCGCTGGATAGCTCATCAGTGCTACAAGCTGGCGTCCAAGACAGGCTTGGGCCACATCCATGACGGG
AGAGGCATCGAATCGACGTCAACCTTTGACAAGCTCTACGGGATTCACGGAGACATCAAACCCGCAAACATCCTG
CTTTACAGGGACCAGGAAACTGTCCACGGCCCGGGCGTGCTCAAGATCTCCGACATGGGCTTCACAGACTTCCAC
TCAGTCCAATCGAGATCGATGCAACCGCCTTTGAGACCCCATTCGCCGGCTTACAGAGCTCCGGAGCACGGCATG
AAAACCATCTTCCTCTCTCGCAAGTACGACATTTGGGGGCTCGGCTGCGTCTTTTCCGAGTTACTGTCGTGGTTC
ATTCGCGGGCCCAACGGCGTCAAGAACTACAGCTGGAAGCGCCGCAACGACAAGTACGACGACGATCGTTGGGGA
GGCGATGATTTCTTCCGGCATTTTTATAACGAGGACAACCTCGTCGTCCATGCGGACCTGAAGCCGTCGGTCATC
AGGTGGATAAACGAACTCTGCAATATCGTTGGGACGACCAATTTTTTAAGCGACTTCCTCAACTACATCAAGGAC
CGCATGCTCGTCGTCGACTGTGACCAGCGAGCTACATGCGACGAGGTCAGTGATTTTCTCCGCCAACTATACAAT
CACTGCCTCGTCAACGAACAATACTGCACCAGTCATCTGCCCTTTCACATGGAAGACTTGGAAGAACAGGAAGAA
CAGCAGAAACGGGAACAACAGGTGAGATTGAAGCGGGGGGCGTCTGATTTCGGCACCAACTCTCACGATCCACGA
TTCAAGCGAGCTAGATACTTCAGAGGCTAG
Transcript >Ophun1|5277
ATGAGCCTTCGATCGCGATTACGGTTGACGGCCCAGTGCAACGGTCGCCACTTCTTCTATCCAGCCGGAGAGATC
CGGTCCATCTTCCAGACTGAGGCCATCGAGATCGAGTTGGCGGCCGTCTTTCCGGACTGGACCCCGGCCAAGGTG
ACGGCCCGCGCCGAACTAGCCTGCAGCGACGGCATGGACGGGCCGGAGTCCATCACGAGGCTTTTTGTCATCCTG
GTGCTCATCCACCGGTTGCAAGACCTTGAGTCTTTCATTGACGAGAAGATCAAGGACTGTCATTTGCCGCTGTGG
CTCGGGAGAGGAGGCAGCGGGCTGTTCCTCGGCCCCAACGATACCGGCCCGGTTGGATCCTGCCACAGATGGGAG
CTGGACTCGATCGACGACTTTAATTACGTCCAAAAAAAGGTCCTCGCTCCTTGCTTCCAGGATAAGGCCGCCGGG
GCTGTCACCTCCCAGCTCATCAAGCCGGATGTTTTCATGCCCTGGACCGAGAAAGAGCCCGTCGCAGAAATCCTG
CACGGCAACTACTCGAGCGTTTACGCCGTCAAGATTCACAAGGATCATCACCAGTTTAGGGTGAATGGGGAGCGG
TGTGACAAGTTTGCGCTCAAAGTTCTCAAGACACGGATTAGAGACCAGTTTTTGAAGGAGCTCAGATGCCTCAAC
TTGTGCGCGGACAGGGACAACCTGGTCGAGCTGTACAGCGCCTACGAGCAAGGCGGCATCTACTCATTCCTCTTC
CCCTGGGCTCATGGCGGCTCTCTCCTGACGCTCTGGGATTTGGATCCAGAGACCTGGAGCCAGTCGAACGTGGTC
AACTCTGTGCGCTGGATAGCTCATCAGTGCTACAAGCTGGCGTCCAAGACAGGCTTGGGCCACATCCATGACGGG
AGAGGCATCGAATCGACGTCAACCTTTGACAAGCTCTACGGGATTCACGGAGACATCAAACCCGCAAACATCCTG
CTTTACAGGGACCAGGAAACTGTCCACGGCCCGGGCGTGCTCAAGATCTCCGACATGGGCTTCACAGACTTCCAC
TCAGTCCAATCGAGATCGATGCAACCGCCTTTGAGACCCCATTCGCCGGCTTACAGAGCTCCGGAGCACGGCATG
AAAACCATCTTCCTCTCTCGCAAGTACGACATTTGGGGGCTCGGCTGCGTCTTTTCCGAGTTACTGTCGTGGTTC
ATTCGCGGGCCCAACGGCGTCAAGAACTACAGCTGGAAGCGCCGCAACGACAAGTACGACGACGATCGTTGGGGA
GGCGATGATTTCTTCCGGCATTTTTATAACGAGGACAACCTCGTCGTCCATGCGGACCTGAAGCCGTCGGTCATC
AGGTGGATAAACGAACTCTGCAATATCGTTGGGACGACCAATTTTTTAAGCGACTTCCTCAACTACATCAAGGAC
CGCATGCTCGTCGTCGACTGTGACCAGCGAGCTACATGCGACGAGGTCAGTGATTTTCTCCGCCAACTATACAAT
CACTGCCTCGTCAACGAACAATACTGCACCAGTCATCTGCCCTTTCACATGGAAGACTTGGAAGAACAGGAAGAA
CAGCAGAAACGGGAACAACAGGTGAGATTGAAGCGGGGGGCGTCTGATTTCGGCACCAACTCTCACGATCCACGA
TTCAAGCGAGCTAGATACTTCAGAGGCTAG
Gene >Ophun1|5277
ATGAGCCTTCGATCGCGATTACGGTTGACGGCCCAGTGCAACGGTCGCCACTTCTTCTATCCAGCCGGAGAGATC
CGGTCCATCTTCCAGACTGAGGCCATCGAGATCGAGTTGGCGGCCGTCTTTCCGGACTGGACCCCGGCCAAGGTG
ACGGCCCGCGCCGAACTAGCCTGCAGCGACGGCATGGACGGGCCGGAGTCCATCACGAGGCTTTTTGTCATCCTG
GTGCTCATCCACCGGTTGCAAGACCTTGAGTCTTTCATTGACGAGAAGATCAAGGACTGTCATTTGCCGCTGTGG
CTCGGGAGAGGAGGCAGCGGGCTGTTCCTCGGCCCCAACGATACCGGCCCGGTTGGATCCTGCCACAGATGGGAG
CTGGACTCGATCGACGACTTTAATTACGTCCAAAAAAAGGTCCTCGCTCCTTGCTTCCAGGATAAGGCCGCCGGG
GCTGTCACCTCCCAGCTCATCAAGCCGGATGTTTTCATGCCCTGGACCGAGAAAGAGCCCGTCGCAGAAATCCTG
CACGGCAACTACTCGAGCGTTTACGCCGTCAAGATTCACAAGGATCATCACCAGTTTGTGCGGCATGACTTCAAA
TCCTAATCCTTTTCTCCGTAACTGTCACTGACTTGCCAGTAGAGGGTGAATGGGGAGCGGTGTGACAAGTTTGCG
CTCAAAGTTCTCAAGACACGGATTAGAGACCAGTTTTTGAAGGAGCTCAGATGCCTCAACTTGTGCGCGGACAGG
GACAACCTGGTCGAGCTGTACAGCGCCTACGAGCAAGGCGGCATCTACTCATTCCTCTTCCCCTGGGCTCATGGC
GGCTCTCTCCTGACGCTCTGGGATTTGGATCCAGAGACCTGGAGCCAGTCGAACGTGGTCAACTCTGTGCGCTGG
ATAGCTCATCAGTGCTACAAGCTGGCGTCCAAGACAGGCTTGGGCCACATCCATGACGGGAGAGGCATCGAATCG
ACGTCAACCTTTGACAAGCTCTACGGGATTCACGGAGACATCAAACCCGCAAACATCCTGCTTTACAGGGACCAG
GAAACTGTCCACGGCCCGGGCGTGCTCAAGATCTCCGACATGGGCTTCACAGACTTCCACTCAGTCCAATCGAGA
TCGATGCAACCGCCTTTGAGACCCCATTCGCCGGCTTACAGAGCTCCGGAGCACGGCATGAAAACCATCTTCCTC
TCTCGCAAGTACGACATTTGGGGGCTCGGCTGCGTCTTTTCCGAGTTACTGTCGTGGTTCATTCGCGGGCCCAAC
GGCGTCAAGAACTACAGCTGGAAGCGCCGCAACGACAAGTACGACGACGATCGTTGGGGAGGCGATGATTTCTTC
CGGCATTTTTATAACGAGGACAACCTCGTCGTCCATGCGGACCTGAAGCCGTCGGTCATCAGGGTAAGCCAGGGG
TGCTGCATCCGTCACCAGGATGCTAATAATGAAAGCAGTGGATAAACGAACTCTGCAATATCGTTGGGACGACCA
ATTTTTTAAGCGACTTCCTCAACTACATCAAGGACCGCATGCTCGTCGTCGACTGTGACCAGCGAGCTACATGCG
ACGAGGTCAGTGATTTTCTCCGCCAACTATACAATCACTGCCTCGTCAACGAACAATACTGCACCAGTCATCTGC
CCTTTCACATGGAAGACTTGGAAGAACAGGAAGAACAGCAGAAACGGGAACAACAGGTGAGATTGAAGCGGGGGG
CGTCTGATTTCGGCACCAACTCTCACGATCCACGATTCAAGCGAGCTAGATACTTCAGAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail