Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5264
Gene name
LocationContig_51:21771..25632
Strand-
Gene length (bp)3861
Transcript length (bp)3861
Coding sequence length (bp)3861
Protein length (aa) 1287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08487 VIT Vault protein inter-alpha-trypsin domain 4.3E-31 139 251
PF13768 VWA_3 von Willebrand factor type A domain 3.3E-17 423 583
PF13519 VWA_2 von Willebrand factor type A domain 2.8E-08 424 534
PF00092 VWA von Willebrand factor type A domain 3.9E-07 424 580
PF13757 VIT_2 Vault protein inter-alpha-trypsin domain 7.7E-07 131 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 112 758 7.0E-28
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 136 760 6.0E-25
sp|Q75WE7|VWA5A_RAT von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus GN=Vwa5a PE=2 SV=1 136 760 5.0E-24
sp|Q54MG4|Y5975_DICDI von Willebrand factor A domain-containing protein DDB_G0285975 OS=Dictyostelium discoideum GN=DDB_G0285975 PE=3 SV=1 421 757 4.0E-23
sp|Q54MG1|Y5981_DICDI von Willebrand factor A domain-containing protein DDB_G0285981 OS=Dictyostelium discoideum GN=DDB_G0285981 PE=3 SV=1 421 757 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 112 758 7.0E-28
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 136 760 6.0E-25
sp|Q75WE7|VWA5A_RAT von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus GN=Vwa5a PE=2 SV=1 136 760 5.0E-24
sp|Q54MG4|Y5975_DICDI von Willebrand factor A domain-containing protein DDB_G0285975 OS=Dictyostelium discoideum GN=DDB_G0285975 PE=3 SV=1 421 757 4.0E-23
sp|Q54MG1|Y5981_DICDI von Willebrand factor A domain-containing protein DDB_G0285981 OS=Dictyostelium discoideum GN=DDB_G0285981 PE=3 SV=1 421 757 1.0E-22
sp|Q54DV3|Y2016_DICDI von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum GN=DDB_G0292016 PE=3 SV=1 158 758 2.0E-22
sp|Q99KC8|VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus GN=Vwa5a PE=1 SV=2 136 582 1.0E-20
sp|Q54CQ8|Y2740_DICDI von Willebrand factor A domain-containing protein DDB_G0292740 OS=Dictyostelium discoideum GN=DDB_G0292740 PE=3 SV=1 421 758 1.0E-20
sp|A9Z1V5|VW5B1_MOUSE von Willebrand factor A domain-containing protein 5B1 OS=Mus musculus GN=Vwa5b1 PE=2 SV=1 223 609 2.0E-19
sp|Q9UKK3|PARP4_HUMAN Poly [ADP-ribose] polymerase 4 OS=Homo sapiens GN=PARP4 PE=1 SV=3 136 756 3.0E-19
sp|Q5TIE3|VW5B1_HUMAN von Willebrand factor A domain-containing protein 5B1 OS=Homo sapiens GN=VWA5B1 PE=1 SV=2 399 609 2.0E-18
sp|C7G046|Y6969_DICDI von Willebrand factor A domain-containing protein DDB_G0286969 OS=Dictyostelium discoideum GN=DDB_G0286969 PE=3 SV=1 394 758 2.0E-17
sp|Q8BJD1|ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus GN=Itih5 PE=1 SV=1 170 577 6.0E-09
sp|Q14624|ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens GN=ITIH4 PE=1 SV=4 424 584 5.0E-07
sp|Q55G98|Y7758_DICDI von Willebrand factor A domain-containing protein DDB_G0267758 OS=Dictyostelium discoideum GN=DDB_G0267758 PE=3 SV=1 421 688 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3548
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5264 (this protein)
Ophiocordyceps kimflemingae Ophio5|1440
Ophiocordyceps kimflemingae Ophio5|3578
Ophiocordyceps subramaniannii Hirsu2|6806
Ophiocordyceps subramaniannii Hirsu2|6807

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5264
MNRTLKTKRLASGVLFSPPADLNNWGDDIPVPQKRETSATIRPYYDHHHGPQTALAGTGGQQAPSNFVNFACSDN
TGDTDWPPSTLGEHRDIFPIFARRSTLKGRAKQPLTDSNTFSIPKDPSRNTKYPPGTTLCLPLLSVAADVTVDGI
VAMTELRQSFRNPSTINIPEARHTFPLYDGAVVTSFECTIGQDRFLRGVVKPKEQARKEFEKARAEKRETAALLE
ELTPEIFETSLGNIPPATTLEVKLTYVHELKAVTMAEEMTEGLAVTIPLSIAPRYGAPVSMPAPELPGNKLDLWI
RVLDDGSVNPGGCHVESEHDTRYVGRQSARKPVASSLAELASLSEPSSVVKKPTMQFVWHYSSDSSVLKTDFVLV
LQMAQGDRLRSRAVLAPADDSGLAALMIKLRPNDLFGSAVQPQKFEGEILFVLDRSSSMGWGNGSSKIDVLRGAM
ALALSGLPSTCVFNIISFGNEVRGLWHESQSAGDAANIQHARDHLPYIKADMGGTEVLLALRGAVEHRMESRSST
QVILITDGEVWDHLNYILDFVWQTRKELADKVRFFTLGIGHSVSHHLVEGIADLGGGYCDVVDVVKHPRWESRFN
RMLRSAMEPDSWTCDVSLGSGYERKSLLECRFDEGQFKDKSEMPVFQAPYPLPPLHPYSYKSVFYLLRLENREPP
SKVFVQTTTDGAKKKVYPLDVETASFNGGTIHHLAAKAVLLNLEDEVNRQTDSNSEMARLNAESLGARYSVASKW
TSFVAVAEDMEAQIDLYKSPLQEMEVQQLLSLKDDEESNHSSSCLKDSHSSKIFRGLHAKIKPVGLVQDDDESDS
DDGLFAKPIGPSHQATYLPVVPLQNAALMGSYQLGPATQVQSKQQDRVSQKPMLECPPSPVQIEPGQRVQNMNMS
RPQRSSHGFYDDGQTLYPHAGSFEPLNSIEATSEPPRQMHQQSISGQVYDEITQIRTAQQQQAQQQQARQLKARM
DMASMARMPPRNRQKSSTLPSPPAMMQRQLPNRQAATEPSGQTSLAQSNAEVASSSSSTGPNRITSAPESSLSAE
LRLPEFEFQPSFHDIIPPTKSEEPSAHQHPPKGPITCEDVIQCQTNEGFDLPPDVQARLGKHYCIGTDIRIRELL
DPLSSSTINQETLNVLANTLMMICFFRTHLISEEDTWYLVIDNAERSVLQALGFKDDEEKKLEGVYYTLGQTLAH
SNFLMSSRSRFRKQKGPPKTPAGARPRVCSVCDEEYDVHVTFVCWHDDCYRPPLLGGRRTWCSWDEFWDHQVSEG
HFVCPGDEQAT*
Coding >Ophun1|5264
ATGAACCGCACTCTCAAGACCAAGCGTCTCGCCTCGGGCGTTCTCTTCTCTCCGCCCGCCGATCTGAACAATTGG
GGAGACGATATTCCTGTCCCCCAGAAAAGGGAAACGTCCGCTACCATCAGGCCGTATTATGACCATCATCATGGG
CCGCAGACAGCCCTGGCCGGGACTGGAGGTCAACAGGCTCCGTCAAATTTCGTCAACTTCGCCTGCTCGGACAAC
ACAGGAGACACAGACTGGCCACCGAGCACATTGGGAGAACACAGAGACATCTTCCCCATCTTTGCAAGGCGTTCC
ACACTCAAGGGACGAGCGAAGCAGCCGTTGACCGACTCGAACACCTTCTCAATCCCCAAAGACCCCTCCCGAAAC
ACCAAATACCCGCCCGGAACGACATTGTGTCTCCCACTGCTGAGCGTGGCGGCCGACGTGACAGTCGACGGCATC
GTCGCCATGACGGAGCTCCGACAGAGCTTCCGGAACCCATCCACCATCAACATCCCCGAAGCTCGCCATACGTTT
CCTCTCTACGATGGCGCCGTCGTCACCTCGTTCGAGTGTACCATCGGTCAAGACCGTTTCCTTAGAGGCGTCGTC
AAGCCAAAGGAGCAGGCTAGGAAAGAGTTCGAAAAGGCACGGGCAGAGAAACGCGAGACGGCTGCTCTACTAGAA
GAGCTCACGCCCGAAATATTCGAGACATCGCTGGGCAACATCCCACCCGCAACCACGCTGGAAGTCAAGTTGACG
TACGTTCACGAGCTCAAAGCCGTCACCATGGCGGAGGAGATGACCGAGGGCCTCGCCGTCACCATCCCCCTTTCC
ATCGCTCCCCGATACGGCGCTCCGGTCTCTATGCCGGCTCCGGAACTCCCCGGAAACAAGCTGGACCTCTGGATC
CGCGTCCTTGATGACGGGTCTGTCAATCCCGGAGGCTGCCACGTCGAGTCGGAGCACGATACTCGGTATGTAGGC
CGTCAATCAGCCCGGAAGCCGGTTGCCAGCAGCCTGGCGGAACTGGCCAGTCTCTCGGAGCCGTCATCAGTGGTG
AAGAAGCCGACGATGCAGTTCGTCTGGCACTACTCATCAGACTCGTCTGTGCTTAAGACGGACTTTGTTCTCGTT
CTTCAGATGGCTCAGGGGGATCGGCTGCGTTCTCGAGCCGTGTTGGCTCCCGCGGATGACAGCGGACTCGCAGCT
CTGATGATCAAGCTGCGGCCCAACGACCTCTTTGGAAGCGCTGTTCAGCCGCAGAAATTTGAGGGCGAGATTCTA
TTCGTTCTGGATCGTTCTTCTTCAATGGGTTGGGGCAATGGTAGCTCCAAGATAGATGTCCTCCGCGGAGCCATG
GCTCTGGCCCTCTCAGGTCTGCCCTCTACCTGTGTCTTCAACATCATCTCCTTTGGCAACGAGGTTCGTGGTCTA
TGGCACGAGTCACAGTCCGCTGGCGATGCTGCCAATATCCAGCACGCGAGAGATCATCTCCCCTATATCAAGGCC
GACATGGGCGGCACAGAGGTGCTCCTCGCGCTGAGAGGCGCTGTAGAACACCGAATGGAAAGTCGATCGTCAACG
CAGGTCATTCTCATCACTGACGGCGAGGTCTGGGATCATCTCAACTACATCTTGGACTTTGTGTGGCAGACGCGC
AAGGAGCTGGCTGATAAAGTGCGCTTCTTTACCCTCGGAATCGGCCACAGCGTCTCTCATCATCTTGTCGAGGGC
ATCGCCGACTTAGGAGGGGGGTACTGCGATGTTGTCGACGTGGTAAAGCATCCTCGATGGGAAAGCCGCTTCAAT
CGCATGCTCCGCTCTGCCATGGAGCCCGACAGCTGGACTTGTGACGTCAGCTTGGGGTCTGGGTATGAGAGAAAG
AGTCTGCTAGAGTGTCGCTTTGATGAGGGTCAGTTCAAGGATAAGTCGGAGATGCCCGTGTTTCAAGCCCCCTAT
CCGCTCCCGCCGTTGCACCCTTACAGCTACAAGTCGGTCTTTTACCTTCTCCGTCTGGAAAACAGAGAGCCTCCG
AGCAAAGTGTTTGTCCAAACGACTACGGACGGCGCCAAGAAAAAGGTGTATCCGCTGGATGTCGAGACGGCCAGC
TTCAACGGGGGAACGATTCATCATCTCGCAGCCAAGGCAGTCCTCCTCAACCTAGAAGACGAGGTCAACAGACAG
ACAGACTCCAATTCTGAGATGGCACGCCTCAACGCCGAGTCTCTTGGAGCTAGATACTCGGTCGCCAGCAAGTGG
ACGAGCTTCGTCGCCGTGGCCGAGGACATGGAGGCTCAGATTGACCTTTACAAGAGCCCGCTGCAGGAGATGGAG
GTGCAGCAGTTGCTGAGCCTGAAAGACGACGAGGAATCGAACCATTCAAGTTCATGCTTGAAAGACTCACACTCG
TCGAAAATATTCAGAGGGTTACATGCAAAGATCAAACCCGTTGGCCTTGTTCAGGATGACGACGAGTCAGACTCG
GACGATGGTTTGTTTGCCAAGCCGATTGGGCCTTCGCACCAGGCCACTTACTTGCCTGTTGTGCCGCTCCAAAAT
GCAGCATTGATGGGTAGTTACCAGCTCGGGCCAGCAACACAAGTTCAATCTAAGCAACAGGATCGAGTCTCGCAA
AAGCCCATGCTCGAGTGCCCACCGAGTCCTGTACAGATAGAACCTGGCCAGCGAGTTCAGAACATGAATATGTCC
CGGCCACAGCGCTCCAGTCACGGCTTCTACGATGACGGACAGACACTGTACCCACATGCCGGCTCATTTGAGCCC
CTGAATTCAATCGAGGCAACTTCTGAGCCGCCTCGGCAGATGCATCAGCAGTCGATATCTGGACAGGTGTATGAC
GAGATAACTCAGATACGGACAGCTCAGCAGCAACAAGCTCAGCAGCAACAAGCTCGGCAGCTGAAGGCTCGGATG
GATATGGCTAGCATGGCTAGGATGCCCCCCAGGAACCGGCAAAAGTCAAGCACACTTCCAAGCCCCCCCGCCATG
ATGCAACGACAGCTCCCCAACCGTCAAGCTGCCACTGAGCCGTCTGGGCAAACATCACTGGCTCAATCCAACGCT
GAAGTTGCGTCTTCGTCATCCTCCACGGGCCCCAATCGCATCACATCAGCCCCCGAGAGTAGCCTCAGCGCCGAG
TTGAGACTCCCTGAATTCGAGTTTCAACCTTCATTCCACGACATCATCCCTCCCACCAAGTCCGAAGAGCCTTCA
GCACATCAGCATCCCCCCAAAGGCCCCATCACTTGCGAGGACGTTATACAGTGCCAGACAAACGAAGGCTTCGAT
CTTCCTCCCGATGTACAAGCGAGGCTCGGTAAGCACTATTGCATCGGAACAGACATTCGAATCCGGGAGCTACTC
GATCCTCTCTCGTCCAGCACCATCAATCAAGAGACTCTGAACGTGTTGGCAAATACACTCATGATGATCTGCTTC
TTCCGCACTCATCTTATCTCCGAGGAAGACACCTGGTATCTGGTCATCGACAACGCAGAGCGATCCGTCCTACAG
GCCCTCGGCTTCAAAGATGACGAAGAGAAGAAGCTTGAAGGCGTATACTATACGCTAGGACAGACTCTCGCACAC
TCAAACTTTCTCATGTCCTCCCGCTCCCGGTTCCGCAAGCAAAAAGGTCCACCGAAGACGCCGGCTGGAGCGAGA
CCCCGGGTTTGCTCCGTCTGCGATGAGGAGTACGACGTGCACGTTACTTTTGTCTGCTGGCATGATGATTGTTAT
CGTCCGCCCCTGTTGGGCGGGAGGCGGACTTGGTGCAGTTGGGATGAGTTTTGGGATCATCAGGTGTCCGAGGGG
CATTTTGTGTGTCCTGGAGACGAGCAGGCGACGTAG
Transcript >Ophun1|5264
ATGAACCGCACTCTCAAGACCAAGCGTCTCGCCTCGGGCGTTCTCTTCTCTCCGCCCGCCGATCTGAACAATTGG
GGAGACGATATTCCTGTCCCCCAGAAAAGGGAAACGTCCGCTACCATCAGGCCGTATTATGACCATCATCATGGG
CCGCAGACAGCCCTGGCCGGGACTGGAGGTCAACAGGCTCCGTCAAATTTCGTCAACTTCGCCTGCTCGGACAAC
ACAGGAGACACAGACTGGCCACCGAGCACATTGGGAGAACACAGAGACATCTTCCCCATCTTTGCAAGGCGTTCC
ACACTCAAGGGACGAGCGAAGCAGCCGTTGACCGACTCGAACACCTTCTCAATCCCCAAAGACCCCTCCCGAAAC
ACCAAATACCCGCCCGGAACGACATTGTGTCTCCCACTGCTGAGCGTGGCGGCCGACGTGACAGTCGACGGCATC
GTCGCCATGACGGAGCTCCGACAGAGCTTCCGGAACCCATCCACCATCAACATCCCCGAAGCTCGCCATACGTTT
CCTCTCTACGATGGCGCCGTCGTCACCTCGTTCGAGTGTACCATCGGTCAAGACCGTTTCCTTAGAGGCGTCGTC
AAGCCAAAGGAGCAGGCTAGGAAAGAGTTCGAAAAGGCACGGGCAGAGAAACGCGAGACGGCTGCTCTACTAGAA
GAGCTCACGCCCGAAATATTCGAGACATCGCTGGGCAACATCCCACCCGCAACCACGCTGGAAGTCAAGTTGACG
TACGTTCACGAGCTCAAAGCCGTCACCATGGCGGAGGAGATGACCGAGGGCCTCGCCGTCACCATCCCCCTTTCC
ATCGCTCCCCGATACGGCGCTCCGGTCTCTATGCCGGCTCCGGAACTCCCCGGAAACAAGCTGGACCTCTGGATC
CGCGTCCTTGATGACGGGTCTGTCAATCCCGGAGGCTGCCACGTCGAGTCGGAGCACGATACTCGGTATGTAGGC
CGTCAATCAGCCCGGAAGCCGGTTGCCAGCAGCCTGGCGGAACTGGCCAGTCTCTCGGAGCCGTCATCAGTGGTG
AAGAAGCCGACGATGCAGTTCGTCTGGCACTACTCATCAGACTCGTCTGTGCTTAAGACGGACTTTGTTCTCGTT
CTTCAGATGGCTCAGGGGGATCGGCTGCGTTCTCGAGCCGTGTTGGCTCCCGCGGATGACAGCGGACTCGCAGCT
CTGATGATCAAGCTGCGGCCCAACGACCTCTTTGGAAGCGCTGTTCAGCCGCAGAAATTTGAGGGCGAGATTCTA
TTCGTTCTGGATCGTTCTTCTTCAATGGGTTGGGGCAATGGTAGCTCCAAGATAGATGTCCTCCGCGGAGCCATG
GCTCTGGCCCTCTCAGGTCTGCCCTCTACCTGTGTCTTCAACATCATCTCCTTTGGCAACGAGGTTCGTGGTCTA
TGGCACGAGTCACAGTCCGCTGGCGATGCTGCCAATATCCAGCACGCGAGAGATCATCTCCCCTATATCAAGGCC
GACATGGGCGGCACAGAGGTGCTCCTCGCGCTGAGAGGCGCTGTAGAACACCGAATGGAAAGTCGATCGTCAACG
CAGGTCATTCTCATCACTGACGGCGAGGTCTGGGATCATCTCAACTACATCTTGGACTTTGTGTGGCAGACGCGC
AAGGAGCTGGCTGATAAAGTGCGCTTCTTTACCCTCGGAATCGGCCACAGCGTCTCTCATCATCTTGTCGAGGGC
ATCGCCGACTTAGGAGGGGGGTACTGCGATGTTGTCGACGTGGTAAAGCATCCTCGATGGGAAAGCCGCTTCAAT
CGCATGCTCCGCTCTGCCATGGAGCCCGACAGCTGGACTTGTGACGTCAGCTTGGGGTCTGGGTATGAGAGAAAG
AGTCTGCTAGAGTGTCGCTTTGATGAGGGTCAGTTCAAGGATAAGTCGGAGATGCCCGTGTTTCAAGCCCCCTAT
CCGCTCCCGCCGTTGCACCCTTACAGCTACAAGTCGGTCTTTTACCTTCTCCGTCTGGAAAACAGAGAGCCTCCG
AGCAAAGTGTTTGTCCAAACGACTACGGACGGCGCCAAGAAAAAGGTGTATCCGCTGGATGTCGAGACGGCCAGC
TTCAACGGGGGAACGATTCATCATCTCGCAGCCAAGGCAGTCCTCCTCAACCTAGAAGACGAGGTCAACAGACAG
ACAGACTCCAATTCTGAGATGGCACGCCTCAACGCCGAGTCTCTTGGAGCTAGATACTCGGTCGCCAGCAAGTGG
ACGAGCTTCGTCGCCGTGGCCGAGGACATGGAGGCTCAGATTGACCTTTACAAGAGCCCGCTGCAGGAGATGGAG
GTGCAGCAGTTGCTGAGCCTGAAAGACGACGAGGAATCGAACCATTCAAGTTCATGCTTGAAAGACTCACACTCG
TCGAAAATATTCAGAGGGTTACATGCAAAGATCAAACCCGTTGGCCTTGTTCAGGATGACGACGAGTCAGACTCG
GACGATGGTTTGTTTGCCAAGCCGATTGGGCCTTCGCACCAGGCCACTTACTTGCCTGTTGTGCCGCTCCAAAAT
GCAGCATTGATGGGTAGTTACCAGCTCGGGCCAGCAACACAAGTTCAATCTAAGCAACAGGATCGAGTCTCGCAA
AAGCCCATGCTCGAGTGCCCACCGAGTCCTGTACAGATAGAACCTGGCCAGCGAGTTCAGAACATGAATATGTCC
CGGCCACAGCGCTCCAGTCACGGCTTCTACGATGACGGACAGACACTGTACCCACATGCCGGCTCATTTGAGCCC
CTGAATTCAATCGAGGCAACTTCTGAGCCGCCTCGGCAGATGCATCAGCAGTCGATATCTGGACAGGTGTATGAC
GAGATAACTCAGATACGGACAGCTCAGCAGCAACAAGCTCAGCAGCAACAAGCTCGGCAGCTGAAGGCTCGGATG
GATATGGCTAGCATGGCTAGGATGCCCCCCAGGAACCGGCAAAAGTCAAGCACACTTCCAAGCCCCCCCGCCATG
ATGCAACGACAGCTCCCCAACCGTCAAGCTGCCACTGAGCCGTCTGGGCAAACATCACTGGCTCAATCCAACGCT
GAAGTTGCGTCTTCGTCATCCTCCACGGGCCCCAATCGCATCACATCAGCCCCCGAGAGTAGCCTCAGCGCCGAG
TTGAGACTCCCTGAATTCGAGTTTCAACCTTCATTCCACGACATCATCCCTCCCACCAAGTCCGAAGAGCCTTCA
GCACATCAGCATCCCCCCAAAGGCCCCATCACTTGCGAGGACGTTATACAGTGCCAGACAAACGAAGGCTTCGAT
CTTCCTCCCGATGTACAAGCGAGGCTCGGTAAGCACTATTGCATCGGAACAGACATTCGAATCCGGGAGCTACTC
GATCCTCTCTCGTCCAGCACCATCAATCAAGAGACTCTGAACGTGTTGGCAAATACACTCATGATGATCTGCTTC
TTCCGCACTCATCTTATCTCCGAGGAAGACACCTGGTATCTGGTCATCGACAACGCAGAGCGATCCGTCCTACAG
GCCCTCGGCTTCAAAGATGACGAAGAGAAGAAGCTTGAAGGCGTATACTATACGCTAGGACAGACTCTCGCACAC
TCAAACTTTCTCATGTCCTCCCGCTCCCGGTTCCGCAAGCAAAAAGGTCCACCGAAGACGCCGGCTGGAGCGAGA
CCCCGGGTTTGCTCCGTCTGCGATGAGGAGTACGACGTGCACGTTACTTTTGTCTGCTGGCATGATGATTGTTAT
CGTCCGCCCCTGTTGGGCGGGAGGCGGACTTGGTGCAGTTGGGATGAGTTTTGGGATCATCAGGTGTCCGAGGGG
CATTTTGTGTGTCCTGGAGACGAGCAGGCGACGTAG
Gene >Ophun1|5264
ATGAACCGCACTCTCAAGACCAAGCGTCTCGCCTCGGGCGTTCTCTTCTCTCCGCCCGCCGATCTGAACAATTGG
GGAGACGATATTCCTGTCCCCCAGAAAAGGGAAACGTCCGCTACCATCAGGCCGTATTATGACCATCATCATGGG
CCGCAGACAGCCCTGGCCGGGACTGGAGGTCAACAGGCTCCGTCAAATTTCGTCAACTTCGCCTGCTCGGACAAC
ACAGGAGACACAGACTGGCCACCGAGCACATTGGGAGAACACAGAGACATCTTCCCCATCTTTGCAAGGCGTTCC
ACACTCAAGGGACGAGCGAAGCAGCCGTTGACCGACTCGAACACCTTCTCAATCCCCAAAGACCCCTCCCGAAAC
ACCAAATACCCGCCCGGAACGACATTGTGTCTCCCACTGCTGAGCGTGGCGGCCGACGTGACAGTCGACGGCATC
GTCGCCATGACGGAGCTCCGACAGAGCTTCCGGAACCCATCCACCATCAACATCCCCGAAGCTCGCCATACGTTT
CCTCTCTACGATGGCGCCGTCGTCACCTCGTTCGAGTGTACCATCGGTCAAGACCGTTTCCTTAGAGGCGTCGTC
AAGCCAAAGGAGCAGGCTAGGAAAGAGTTCGAAAAGGCACGGGCAGAGAAACGCGAGACGGCTGCTCTACTAGAA
GAGCTCACGCCCGAAATATTCGAGACATCGCTGGGCAACATCCCACCCGCAACCACGCTGGAAGTCAAGTTGACG
TACGTTCACGAGCTCAAAGCCGTCACCATGGCGGAGGAGATGACCGAGGGCCTCGCCGTCACCATCCCCCTTTCC
ATCGCTCCCCGATACGGCGCTCCGGTCTCTATGCCGGCTCCGGAACTCCCCGGAAACAAGCTGGACCTCTGGATC
CGCGTCCTTGATGACGGGTCTGTCAATCCCGGAGGCTGCCACGTCGAGTCGGAGCACGATACTCGGTATGTAGGC
CGTCAATCAGCCCGGAAGCCGGTTGCCAGCAGCCTGGCGGAACTGGCCAGTCTCTCGGAGCCGTCATCAGTGGTG
AAGAAGCCGACGATGCAGTTCGTCTGGCACTACTCATCAGACTCGTCTGTGCTTAAGACGGACTTTGTTCTCGTT
CTTCAGATGGCTCAGGGGGATCGGCTGCGTTCTCGAGCCGTGTTGGCTCCCGCGGATGACAGCGGACTCGCAGCT
CTGATGATCAAGCTGCGGCCCAACGACCTCTTTGGAAGCGCTGTTCAGCCGCAGAAATTTGAGGGCGAGATTCTA
TTCGTTCTGGATCGTTCTTCTTCAATGGGTTGGGGCAATGGTAGCTCCAAGATAGATGTCCTCCGCGGAGCCATG
GCTCTGGCCCTCTCAGGTCTGCCCTCTACCTGTGTCTTCAACATCATCTCCTTTGGCAACGAGGTTCGTGGTCTA
TGGCACGAGTCACAGTCCGCTGGCGATGCTGCCAATATCCAGCACGCGAGAGATCATCTCCCCTATATCAAGGCC
GACATGGGCGGCACAGAGGTGCTCCTCGCGCTGAGAGGCGCTGTAGAACACCGAATGGAAAGTCGATCGTCAACG
CAGGTCATTCTCATCACTGACGGCGAGGTCTGGGATCATCTCAACTACATCTTGGACTTTGTGTGGCAGACGCGC
AAGGAGCTGGCTGATAAAGTGCGCTTCTTTACCCTCGGAATCGGCCACAGCGTCTCTCATCATCTTGTCGAGGGC
ATCGCCGACTTAGGAGGGGGGTACTGCGATGTTGTCGACGTGGTAAAGCATCCTCGATGGGAAAGCCGCTTCAAT
CGCATGCTCCGCTCTGCCATGGAGCCCGACAGCTGGACTTGTGACGTCAGCTTGGGGTCTGGGTATGAGAGAAAG
AGTCTGCTAGAGTGTCGCTTTGATGAGGGTCAGTTCAAGGATAAGTCGGAGATGCCCGTGTTTCAAGCCCCCTAT
CCGCTCCCGCCGTTGCACCCTTACAGCTACAAGTCGGTCTTTTACCTTCTCCGTCTGGAAAACAGAGAGCCTCCG
AGCAAAGTGTTTGTCCAAACGACTACGGACGGCGCCAAGAAAAAGGTGTATCCGCTGGATGTCGAGACGGCCAGC
TTCAACGGGGGAACGATTCATCATCTCGCAGCCAAGGCAGTCCTCCTCAACCTAGAAGACGAGGTCAACAGACAG
ACAGACTCCAATTCTGAGATGGCACGCCTCAACGCCGAGTCTCTTGGAGCTAGATACTCGGTCGCCAGCAAGTGG
ACGAGCTTCGTCGCCGTGGCCGAGGACATGGAGGCTCAGATTGACCTTTACAAGAGCCCGCTGCAGGAGATGGAG
GTGCAGCAGTTGCTGAGCCTGAAAGACGACGAGGAATCGAACCATTCAAGTTCATGCTTGAAAGACTCACACTCG
TCGAAAATATTCAGAGGGTTACATGCAAAGATCAAACCCGTTGGCCTTGTTCAGGATGACGACGAGTCAGACTCG
GACGATGGTTTGTTTGCCAAGCCGATTGGGCCTTCGCACCAGGCCACTTACTTGCCTGTTGTGCCGCTCCAAAAT
GCAGCATTGATGGGTAGTTACCAGCTCGGGCCAGCAACACAAGTTCAATCTAAGCAACAGGATCGAGTCTCGCAA
AAGCCCATGCTCGAGTGCCCACCGAGTCCTGTACAGATAGAACCTGGCCAGCGAGTTCAGAACATGAATATGTCC
CGGCCACAGCGCTCCAGTCACGGCTTCTACGATGACGGACAGACACTGTACCCACATGCCGGCTCATTTGAGCCC
CTGAATTCAATCGAGGCAACTTCTGAGCCGCCTCGGCAGATGCATCAGCAGTCGATATCTGGACAGGTGTATGAC
GAGATAACTCAGATACGGACAGCTCAGCAGCAACAAGCTCAGCAGCAACAAGCTCGGCAGCTGAAGGCTCGGATG
GATATGGCTAGCATGGCTAGGATGCCCCCCAGGAACCGGCAAAAGTCAAGCACACTTCCAAGCCCCCCCGCCATG
ATGCAACGACAGCTCCCCAACCGTCAAGCTGCCACTGAGCCGTCTGGGCAAACATCACTGGCTCAATCCAACGCT
GAAGTTGCGTCTTCGTCATCCTCCACGGGCCCCAATCGCATCACATCAGCCCCCGAGAGTAGCCTCAGCGCCGAG
TTGAGACTCCCTGAATTCGAGTTTCAACCTTCATTCCACGACATCATCCCTCCCACCAAGTCCGAAGAGCCTTCA
GCACATCAGCATCCCCCCAAAGGCCCCATCACTTGCGAGGACGTTATACAGTGCCAGACAAACGAAGGCTTCGAT
CTTCCTCCCGATGTACAAGCGAGGCTCGGTAAGCACTATTGCATCGGAACAGACATTCGAATCCGGGAGCTACTC
GATCCTCTCTCGTCCAGCACCATCAATCAAGAGACTCTGAACGTGTTGGCAAATACACTCATGATGATCTGCTTC
TTCCGCACTCATCTTATCTCCGAGGAAGACACCTGGTATCTGGTCATCGACAACGCAGAGCGATCCGTCCTACAG
GCCCTCGGCTTCAAAGATGACGAAGAGAAGAAGCTTGAAGGCGTATACTATACGCTAGGACAGACTCTCGCACAC
TCAAACTTTCTCATGTCCTCCCGCTCCCGGTTCCGCAAGCAAAAAGGTCCACCGAAGACGCCGGCTGGAGCGAGA
CCCCGGGTTTGCTCCGTCTGCGATGAGGAGTACGACGTGCACGTTACTTTTGTCTGCTGGCATGATGATTGTTAT
CGTCCGCCCCTGTTGGGCGGGAGGCGGACTTGGTGCAGTTGGGATGAGTTTTGGGATCATCAGGTGTCCGAGGGG
CATTTTGTGTGTCCTGGAGACGAGCAGGCGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail