Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5260
Gene name
LocationContig_51:11973..14418
Strand-
Gene length (bp)2445
Transcript length (bp)2337
Coding sequence length (bp)2337
Protein length (aa) 779

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00365 PFK Phosphofructokinase 2.8E-103 1 307
PF00365 PFK Phosphofructokinase 1.3E-81 389 685

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4W9B8|PFKA_ASPFU ATP-dependent 6-phosphofructokinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfkA PE=3 SV=1 1 758 0.0E+00
sp|P78985|PFKA_ASPNG ATP-dependent 6-phosphofructokinase OS=Aspergillus niger GN=pfkA PE=3 SV=1 1 752 0.0E+00
sp|Q9HGZ1|PFKA1_ASPOR ATP-dependent 6-phosphofructokinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfkA PE=2 SV=1 1 755 0.0E+00
sp|O42938|PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfk1 PE=1 SV=1 1 752 0.0E+00
sp|C4QXA5|PFKA2_PICPG ATP-dependent 6-phosphofructokinase subunit beta OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PFK2 PE=3 SV=2 1 752 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4W9B8|PFKA_ASPFU ATP-dependent 6-phosphofructokinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfkA PE=3 SV=1 1 758 0.0E+00
sp|P78985|PFKA_ASPNG ATP-dependent 6-phosphofructokinase OS=Aspergillus niger GN=pfkA PE=3 SV=1 1 752 0.0E+00
sp|Q9HGZ1|PFKA1_ASPOR ATP-dependent 6-phosphofructokinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfkA PE=2 SV=1 1 755 0.0E+00
sp|O42938|PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfk1 PE=1 SV=1 1 752 0.0E+00
sp|C4QXA5|PFKA2_PICPG ATP-dependent 6-phosphofructokinase subunit beta OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PFK2 PE=3 SV=2 1 752 0.0E+00
sp|Q8TGA0|PFKA2_PICPA ATP-dependent 6-phosphofructokinase subunit beta OS=Komagataella pastoris GN=PFK2 PE=1 SV=1 1 752 0.0E+00
sp|P16862|PFKA2_YEAST ATP-dependent 6-phosphofructokinase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK2 PE=1 SV=4 1 752 0.0E+00
sp|O94200|PFKA2_CANAX ATP-dependent 6-phosphofructokinase subunit beta OS=Candida albicans GN=PFK2 PE=1 SV=1 1 758 0.0E+00
sp|Q9HGZ0|PFKA2_ASPOR ATP-dependent 6-phosphofructokinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfkB PE=2 SV=1 1 752 0.0E+00
sp|O94201|PFKA1_CANAX ATP-dependent 6-phosphofructokinase subunit alpha OS=Candida albicans GN=PFK1 PE=1 SV=1 1 760 0.0E+00
sp|Q03215|PFKA1_KLULA ATP-dependent 6-phosphofructokinase subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFK1 PE=1 SV=1 1 752 0.0E+00
sp|P16861|PFKA1_YEAST ATP-dependent 6-phosphofructokinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK1 PE=1 SV=1 1 752 0.0E+00
sp|Q03216|PFKA2_KLULA ATP-dependent 6-phosphofructokinase subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFK2 PE=1 SV=2 1 752 0.0E+00
sp|Q8NJU8|PFKA1_PICPA ATP-dependent 6-phosphofructokinase subunit alpha OS=Komagataella pastoris GN=PFK1 PE=1 SV=1 1 752 0.0E+00
sp|Q92448|PFKA1_PICPG ATP-dependent 6-phosphofructokinase subunit alpha OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PFK1 PE=1 SV=2 1 752 0.0E+00
sp|P59680|PFKA_YARLI ATP-dependent 6-phosphofructokinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFK1 PE=2 SV=2 1 759 0.0E+00
sp|P17858|PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens GN=PFKL PE=1 SV=6 1 749 0.0E+00
sp|P12382|PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus GN=Pfkl PE=1 SV=4 1 777 0.0E+00
sp|A1A4J1|PFKAL_BOVIN ATP-dependent 6-phosphofructokinase, liver type OS=Bos taurus GN=PFKL PE=2 SV=1 1 778 0.0E+00
sp|P30835|PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus GN=Pfkl PE=1 SV=3 1 777 0.0E+00
sp|Q5R7V5|PFKAL_PONAB ATP-dependent 6-phosphofructokinase, liver type OS=Pongo abelii GN=PFKL PE=2 SV=1 1 749 0.0E+00
sp|P47860|PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus GN=Pfkp PE=1 SV=2 1 749 0.0E+00
sp|Q01813|PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens GN=PFKP PE=1 SV=2 1 749 0.0E+00
sp|Q867C9|PFKAM_HORSE ATP-dependent 6-phosphofructokinase, muscle type OS=Equus caballus GN=PFKM PE=2 SV=3 1 749 0.0E+00
sp|Q5R636|PFKAP_PONAB ATP-dependent 6-phosphofructokinase, platelet type OS=Pongo abelii GN=PFKP PE=2 SV=1 1 749 0.0E+00
sp|P08237|PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens GN=PFKM PE=1 SV=2 1 749 0.0E+00
sp|P52784|PFKAM_CANLF ATP-dependent 6-phosphofructokinase, muscle type OS=Canis lupus familiaris GN=PFKM PE=2 SV=2 1 749 0.0E+00
sp|Q60HD9|PFKAM_MACFA ATP-dependent 6-phosphofructokinase, muscle type OS=Macaca fascicularis GN=PFKM PE=2 SV=3 1 749 0.0E+00
sp|Q2HYU2|PFKAM_PIG ATP-dependent 6-phosphofructokinase, muscle type OS=Sus scrofa GN=PFKM PE=2 SV=1 1 749 0.0E+00
sp|Q0IIG5|PFKAM_BOVIN ATP-dependent 6-phosphofructokinase, muscle type OS=Bos taurus GN=PFKM PE=2 SV=1 1 749 0.0E+00
sp|Q9TZL8|PFKA1_CAEEL ATP-dependent 6-phosphofructokinase 1 OS=Caenorhabditis elegans GN=pfk-1 PE=3 SV=2 2 750 0.0E+00
sp|P00511|PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus GN=PFKM PE=1 SV=3 1 749 0.0E+00
sp|P47857|PFKAM_MOUSE ATP-dependent 6-phosphofructokinase, muscle type OS=Mus musculus GN=Pfkm PE=1 SV=3 1 749 0.0E+00
sp|Q5RAG9|PFKAM_PONAB ATP-dependent 6-phosphofructokinase, muscle type OS=Pongo abelii GN=PFKM PE=2 SV=1 1 749 0.0E+00
sp|Q9WUA3|PFKAP_MOUSE ATP-dependent 6-phosphofructokinase, platelet type OS=Mus musculus GN=Pfkp PE=1 SV=1 1 749 0.0E+00
sp|P47858|PFKAM_RAT ATP-dependent 6-phosphofructokinase, muscle type OS=Rattus norvegicus GN=Pfkm PE=1 SV=3 1 749 0.0E+00
sp|P47859|PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus GN=PFKP PE=1 SV=1 1 749 0.0E+00
sp|P52034|PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster GN=Pfk PE=2 SV=2 1 739 0.0E+00
sp|Q27778|PFKA_SCHMA ATP-dependent 6-phosphofructokinase OS=Schistosoma mansoni GN=PFK PE=1 SV=1 1 764 0.0E+00
sp|Q27665|PFKA_HAECO ATP-dependent 6-phosphofructokinase OS=Haemonchus contortus GN=PFK PE=2 SV=1 1 749 0.0E+00
sp|P90521|PFKA_DICDI ATP-dependent 6-phosphofructokinase OS=Dictyostelium discoideum GN=pfkA PE=1 SV=2 1 745 0.0E+00
sp|Q27483|PFKA2_CAEEL ATP-dependent 6-phosphofructokinase 2 OS=Caenorhabditis elegans GN=C50F4.2 PE=3 SV=1 1 754 3.0E-139
sp|B9K6R9|PFKA_THENN ATP-dependent 6-phosphofructokinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pfkA PE=3 SV=1 1 342 8.0E-70
sp|B1L9U3|PFKA_THESQ ATP-dependent 6-phosphofructokinase OS=Thermotoga sp. (strain RQ2) GN=pfkA PE=3 SV=1 1 342 3.0E-68
sp|Q9WY52|PFKA_THEMA ATP-dependent 6-phosphofructokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pfkA PE=1 SV=1 1 342 6.0E-68
sp|A5IKL2|PFKA_THEP1 ATP-dependent 6-phosphofructokinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pfkA PE=3 SV=1 1 342 3.0E-67
sp|Q8A624|PFKA2_BACTN ATP-dependent 6-phosphofructokinase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA2 PE=3 SV=1 1 342 4.0E-63
sp|B7GGT1|PFKA_ANOFW ATP-dependent 6-phosphofructokinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pfkA PE=3 SV=1 1 342 4.0E-63
sp|B9DN94|PFKA_STACT ATP-dependent 6-phosphofructokinase OS=Staphylococcus carnosus (strain TM300) GN=pfkA PE=3 SV=1 1 326 1.0E-61
sp|Q8A8R5|PFKA1_BACTN ATP-dependent 6-phosphofructokinase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA1 PE=3 SV=1 1 342 1.0E-60
sp|C5D663|PFKA_GEOSW ATP-dependent 6-phosphofructokinase OS=Geobacillus sp. (strain WCH70) GN=pfkA PE=3 SV=1 1 342 3.0E-60
sp|Q27543|PFKA_CALFI ATP-dependent 6-phosphofructokinase (Fragment) OS=Calanus finmarchicus GN=PFK PE=2 SV=1 97 284 5.0E-60
sp|Q5KWB1|PFKA_GEOKA ATP-dependent 6-phosphofructokinase OS=Geobacillus kaustophilus (strain HTA426) GN=pfkA PE=3 SV=1 1 342 7.0E-60
sp|Q8XNH2|PFKA1_CLOPE ATP-dependent 6-phosphofructokinase 1 OS=Clostridium perfringens (strain 13 / Type A) GN=pfkA1 PE=3 SV=1 1 336 8.0E-60
sp|P00512|PFKA_GEOSE ATP-dependent 6-phosphofructokinase OS=Geobacillus stearothermophilus GN=pfkA PE=1 SV=2 1 336 6.0E-59
sp|B2A6Y0|PFKA_NATTJ ATP-dependent 6-phosphofructokinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pfkA PE=3 SV=1 1 352 8.0E-59
sp|Q8CS68|PFKA_STAES ATP-dependent 6-phosphofructokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pfkA PE=3 SV=2 1 339 2.0E-58
sp|Q5HNK6|PFKA_STAEQ ATP-dependent 6-phosphofructokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pfkA PE=3 SV=1 1 340 2.0E-58
sp|Q6GG08|PFKA_STAAR ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MRSA252) GN=pfkA PE=3 SV=1 1 328 2.0E-58
sp|P65695|PFKA_STAAW ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MW2) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|A8Z2L4|PFKA_STAAT ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|Q6G8M8|PFKA_STAAS ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MSSA476) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|P99165|PFKA_STAAN ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain N315) GN=pfkA PE=1 SV=1 1 328 3.0E-58
sp|P65694|PFKA_STAAM ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|A6QHN3|PFKA_STAAE ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain Newman) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|Q5HF75|PFKA_STAAC ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain COL) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|Q2YTE2|PFKA_STAAB ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|A5ITM2|PFKA_STAA9 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain JH9) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|Q2FXM8|PFKA_STAA8 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain NCTC 8325) GN=pfkA PE=1 SV=2 1 328 3.0E-58
sp|A6U2G5|PFKA_STAA2 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain JH1) GN=pfkA PE=3 SV=1 1 328 3.0E-58
sp|Q9K843|PFKA_BACHD ATP-dependent 6-phosphofructokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pfkA PE=3 SV=1 1 342 5.0E-58
sp|Q5WEF6|PFKA_BACSK ATP-dependent 6-phosphofructokinase OS=Bacillus clausii (strain KSM-K16) GN=pfkA PE=3 SV=1 1 332 1.0E-57
sp|A8FG55|PFKA_BACP2 ATP-dependent 6-phosphofructokinase OS=Bacillus pumilus (strain SAFR-032) GN=pfkA PE=3 SV=1 1 342 2.0E-57
sp|Q817F3|PFKA_BACCR ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pfkA PE=3 SV=1 1 342 4.0E-57
sp|A7GTP4|PFKA_BACCN ATP-dependent 6-phosphofructokinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pfkA PE=3 SV=1 1 338 5.0E-57
sp|O34529|PFKA_BACSU ATP-dependent 6-phosphofructokinase OS=Bacillus subtilis (strain 168) GN=pfkA PE=1 SV=1 1 340 5.0E-57
sp|Q180P4|PFKA_PEPD6 ATP-dependent 6-phosphofructokinase OS=Peptoclostridium difficile (strain 630) GN=pfkA PE=3 SV=1 1 357 2.0E-56
sp|B7HFB3|PFKA_BACC4 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain B4264) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|B7IJZ8|PFKA_BACC2 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain G9842) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q6HCT3|PFKA_BACHK ATP-dependent 6-phosphofructokinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q633J8|PFKA_BACCZ ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ZK / E33L) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|B9J099|PFKA_BACCQ ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain Q1) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q4MVY3|PFKA_BACCE ATP-dependent 6-phosphofructokinase OS=Bacillus cereus GN=pfkA PE=1 SV=1 1 342 2.0E-56
sp|B7HRN9|PFKA_BACC7 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain AH187) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|C1EUU3|PFKA_BACC3 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain 03BB102) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q72ZD8|PFKA_BACC1 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|B7JRX2|PFKA_BACC0 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain AH820) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q81KZ0|PFKA_BACAN ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|A0RJJ6|PFKA_BACAH ATP-dependent 6-phosphofructokinase OS=Bacillus thuringiensis (strain Al Hakam) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|C3L8X8|PFKA_BACAC ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|C3PAI8|PFKA_BACAA ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis (strain A0248) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|A9VJR1|PFKA_BACWK ATP-dependent 6-phosphofructokinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pfkA PE=3 SV=1 1 342 2.0E-56
sp|Q59214|PFKA_PAEMC ATP-dependent 6-phosphofructokinase OS=Paenibacillus macquariensis GN=pfkA PE=3 SV=1 1 341 3.0E-56
sp|C4K7E1|PFKA_HAMD5 ATP-dependent 6-phosphofructokinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pfkA PE=3 SV=1 1 336 3.0E-56
sp|A7Z7K6|PFKA_BACMF ATP-dependent 6-phosphofructokinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pfkA PE=3 SV=1 1 342 8.0E-56
sp|B0S230|PFKA_FINM2 ATP-dependent 6-phosphofructokinase OS=Finegoldia magna (strain ATCC 29328) GN=pfkA PE=3 SV=1 1 336 1.0E-55
sp|B8D1K5|PFKA_HALOH ATP-dependent 6-phosphofructokinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=pfkA PE=3 SV=1 1 346 1.0E-55
sp|Q65G82|PFKA_BACLD ATP-dependent 6-phosphofructokinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pfkA PE=3 SV=1 1 342 2.0E-55
sp|B8DHH7|PFKA_LISMH ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pfkA PE=3 SV=1 1 357 4.0E-55
sp|A0AJ20|PFKA_LISW6 ATP-dependent 6-phosphofructokinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pfkA PE=3 SV=1 1 357 4.0E-55
sp|Q8Y6W0|PFKA_LISMO ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pfkA PE=3 SV=1 1 357 5.0E-55
sp|Q71Z96|PFKA_LISMF ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pfkA PE=3 SV=1 1 357 5.0E-55
sp|C1KVL8|PFKA_LISMC ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pfkA PE=3 SV=1 1 357 5.0E-55
sp|O08308|PFKA_CLOAB ATP-dependent 6-phosphofructokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pfkA PE=3 SV=2 1 336 5.0E-55
sp|B9E7A4|PFKA_MACCJ ATP-dependent 6-phosphofructokinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=pfkA PE=3 SV=1 1 309 5.0E-55
sp|Q92BE4|PFKA_LISIN ATP-dependent 6-phosphofructokinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pfkA PE=3 SV=1 1 357 9.0E-55
sp|Q6CZ46|PFKA_PECAS ATP-dependent 6-phosphofructokinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pfkA PE=3 SV=1 1 340 2.0E-54
sp|C5BC26|PFKA_EDWI9 ATP-dependent 6-phosphofructokinase OS=Edwardsiella ictaluri (strain 93-146) GN=pfkA PE=3 SV=1 1 340 3.0E-54
sp|C6DHK2|PFKA_PECCP ATP-dependent 6-phosphofructokinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pfkA PE=3 SV=1 1 340 4.0E-54
sp|A6TGB8|PFKA_KLEP7 ATP-dependent 6-phosphofructokinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pfkA PE=3 SV=1 1 340 1.0E-53
sp|B5XZ40|PFKA_KLEP3 ATP-dependent 6-phosphofructokinase OS=Klebsiella pneumoniae (strain 342) GN=pfkA PE=3 SV=1 1 340 1.0E-53
sp|A8GLB0|PFKA_SERP5 ATP-dependent 6-phosphofructokinase OS=Serratia proteamaculans (strain 568) GN=pfkA PE=3 SV=1 1 340 1.0E-53
sp|C5BNR1|PFKA_TERTT ATP-dependent 6-phosphofructokinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pfkA PE=3 SV=1 1 338 2.0E-53
sp|A0PYC8|PFKA_CLONN ATP-dependent 6-phosphofructokinase OS=Clostridium novyi (strain NT) GN=pfkA PE=3 SV=1 1 336 2.0E-53
sp|A3CM69|PFKA_STRSV ATP-dependent 6-phosphofructokinase OS=Streptococcus sanguinis (strain SK36) GN=pfkA PE=3 SV=1 1 368 2.0E-53
sp|Q72H98|PFKA_THET2 ATP-dependent 6-phosphofructokinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pfkA PE=3 SV=1 1 342 3.0E-53
sp|P21777|PFKA1_THET8 ATP-dependent 6-phosphofructokinase 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pfkA PE=1 SV=3 1 342 3.0E-53
sp|B0K6L2|PFKA_THEPX ATP-dependent 6-phosphofructokinase OS=Thermoanaerobacter sp. (strain X514) GN=pfkA PE=3 SV=1 1 341 3.0E-53
sp|B0K7U7|PFKA_THEP3 ATP-dependent 6-phosphofructokinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pfkA PE=3 SV=1 1 341 3.0E-53
sp|A4VTS0|PFKA_STRSY ATP-dependent 6-phosphofructokinase OS=Streptococcus suis (strain 05ZYH33) GN=pfkA PE=3 SV=1 1 368 5.0E-53
sp|Q7MGW6|PFKA_VIBVY ATP-dependent 6-phosphofructokinase OS=Vibrio vulnificus (strain YJ016) GN=pfkA PE=3 SV=2 1 340 6.0E-53
sp|Q8DCY1|PFKA_VIBVU ATP-dependent 6-phosphofructokinase OS=Vibrio vulnificus (strain CMCP6) GN=pfkA PE=3 SV=1 1 340 6.0E-53
sp|A7MQ83|PFKA_CROS8 ATP-dependent 6-phosphofructokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pfkA PE=3 SV=1 1 340 1.0E-52
sp|Q2NQX2|PFKA_SODGM ATP-dependent 6-phosphofructokinase OS=Sodalis glossinidius (strain morsitans) GN=pfkA PE=3 SV=1 1 340 1.0E-52
sp|A4TSA7|PFKA_YERPP ATP-dependent 6-phosphofructokinase OS=Yersinia pestis (strain Pestoides F) GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|Q1CD33|PFKA_YERPN ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|A9R6A3|PFKA_YERPG ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|Q8ZJL6|PFKA_YERPE ATP-dependent 6-phosphofructokinase OS=Yersinia pestis GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|Q1C297|PFKA_YERPA ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|A7FCW1|PFKA_YERP3 ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pfkA PE=3 SV=1 1 326 1.0E-52
sp|B1JQU4|PFKA_YERPY ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pfkA PE=3 SV=1 1 326 2.0E-52
sp|Q66GA8|PFKA_YERPS ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pfkA PE=3 SV=1 1 326 2.0E-52
sp|B2JZA3|PFKA_YERPB ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pfkA PE=3 SV=1 1 326 2.0E-52
sp|B1IB66|PFKA_STRPI ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pfkA PE=3 SV=1 1 349 2.0E-52
sp|C1C6M8|PFKA_STRP7 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain 70585) GN=pfkA PE=3 SV=1 1 349 2.0E-52
sp|B5E3Z8|PFKA_STRP4 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pfkA PE=3 SV=1 1 349 2.0E-52
sp|A7MX59|PFKA_VIBCB ATP-dependent 6-phosphofructokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pfkA PE=3 SV=1 1 340 4.0E-52
sp|P80019|PFKA_LACDE ATP-dependent 6-phosphofructokinase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pfkA PE=1 SV=2 1 310 5.0E-52
sp|Q87KX0|PFKA_VIBPA ATP-dependent 6-phosphofructokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pfkA PE=3 SV=1 1 340 5.0E-52
sp|B2VF62|PFKA_ERWT9 ATP-dependent 6-phosphofructokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pfkA PE=3 SV=1 1 340 5.0E-52
sp|Q03F74|PFKA_PEDPA ATP-dependent 6-phosphofructokinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=pfkA PE=3 SV=1 1 327 5.0E-52
sp|Q6LVK2|PFKA_PHOPR ATP-dependent 6-phosphofructokinase OS=Photobacterium profundum GN=pfkA PE=3 SV=1 1 340 6.0E-52
sp|B2UZX8|PFKA_CLOBA ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pfkA PE=3 SV=1 1 336 6.0E-52
sp|B2TQR6|PFKA_CLOBB ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pfkA PE=3 SV=1 1 352 6.0E-52
sp|B7LVC9|PFKA_ESCF3 ATP-dependent 6-phosphofructokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pfkA PE=3 SV=1 1 340 6.0E-52
sp|B2IP53|PFKA_STRPS ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain CGSP14) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|C1CRZ7|PFKA_STRZT ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|C1CJY4|PFKA_STRZP ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain P1031) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|C1CDP4|PFKA_STRZJ ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain JJA) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|Q97RC6|PFKA_STRPN ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|B8ZNU0|PFKA_STRPJ ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pfkA PE=3 SV=1 1 349 1.0E-51
sp|Q8FBD0|PFKA_ECOL6 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pfkA PE=3 SV=2 1 340 1.0E-51
sp|B7UNN6|PFKA_ECO27 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|P65692|PFKA_SALTY ATP-dependent 6-phosphofructokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|P65693|PFKA_SALTI ATP-dependent 6-phosphofructokinase OS=Salmonella typhi GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B4TPS6|PFKA_SALSV ATP-dependent 6-phosphofructokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B5BJI2|PFKA_SALPK ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|C0Q414|PFKA_SALPC ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi C (strain RKS4594) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|A9MZE7|PFKA_SALPB ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|Q5PIR6|PFKA_SALPA ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B4T049|PFKA_SALNS ATP-dependent 6-phosphofructokinase OS=Salmonella newport (strain SL254) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B4TCK0|PFKA_SALHS ATP-dependent 6-phosphofructokinase OS=Salmonella heidelberg (strain SL476) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B5QWZ5|PFKA_SALEP ATP-dependent 6-phosphofructokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B5FPR2|PFKA_SALDC ATP-dependent 6-phosphofructokinase OS=Salmonella dublin (strain CT_02021853) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|Q57HF3|PFKA_SALCH ATP-dependent 6-phosphofructokinase OS=Salmonella choleraesuis (strain SC-B67) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|A9MI50|PFKA_SALAR ATP-dependent 6-phosphofructokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B5F0P6|PFKA_SALA4 ATP-dependent 6-phosphofructokinase OS=Salmonella agona (strain SL483) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|Q9KNP2|PFKA_VIBCH ATP-dependent 6-phosphofructokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pfkA PE=3 SV=2 1 340 1.0E-51
sp|B5RFA9|PFKA_SALG2 ATP-dependent 6-phosphofructokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pfkA PE=3 SV=1 1 340 1.0E-51
sp|B2V7W7|PFKA_SULSY ATP-dependent 6-phosphofructokinase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pfkA PE=3 SV=1 1 332 1.0E-51
sp|Q74JM8|PFKA_LACJO ATP-dependent 6-phosphofructokinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pfkA PE=3 SV=1 1 310 1.0E-51
sp|B6EMS4|PFKA_ALISL ATP-dependent 6-phosphofructokinase OS=Aliivibrio salmonicida (strain LFI1238) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|Q3YV62|PFKA_SHISS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella sonnei (strain Ss046) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|P0A798|PFKA_SHIFL ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella flexneri GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|Q32A80|PFKA_SHIDS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|Q31U74|PFKA_SHIBS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B2TVQ8|PFKA_SHIB3 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B1LNL9|PFKA_ECOSM ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B6I4Q8|PFKA_ECOSE ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain SE11) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7NFL3|PFKA_ECOLU ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|P0A796|PFKA_ECOLI ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12) GN=pfkA PE=1 SV=1 1 340 2.0E-51
sp|B1IVG3|PFKA_ECOLC ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|Q0TAE8|PFKA_ECOL5 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|A8A720|PFKA_ECOHS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O9:H4 (strain HS) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B1XB82|PFKA_ECODH ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12 / DH10B) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|C5A083|PFKA_ECOBW ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7M6W7|PFKA_ECO8A ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O8 (strain IAI1) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7N2Q7|PFKA_ECO81 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O81 (strain ED1a) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7NU91|PFKA_ECO7I ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B5YZ53|PFKA_ECO5E ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|P0A797|PFKA_ECO57 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O157:H7 GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7LA13|PFKA_ECO55 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain 55989 / EAEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|B7MI48|PFKA_ECO45 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|A7ZUC9|PFKA_ECO24 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|A8AL13|PFKA_CITK8 ATP-dependent 6-phosphofructokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|A4WG81|PFKA_ENT38 ATP-dependent 6-phosphofructokinase OS=Enterobacter sp. (strain 638) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|A7GIW9|PFKA_CLOBL ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pfkA PE=3 SV=1 1 336 2.0E-51
sp|B1IFV9|PFKA_CLOBK ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Okra / Type B1) GN=pfkA PE=3 SV=1 1 336 2.0E-51
sp|C1FM55|PFKA_CLOBJ ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pfkA PE=3 SV=1 1 336 2.0E-51
sp|A5I798|PFKA_CLOBH ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pfkA PE=3 SV=1 1 336 2.0E-51
sp|A7FYW7|PFKA_CLOB1 ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pfkA PE=3 SV=1 1 336 2.0E-51
sp|Q1WTT3|PFKA_LACS1 ATP-dependent 6-phosphofructokinase OS=Lactobacillus salivarius (strain UCC118) GN=pfkA PE=3 SV=1 1 340 2.0E-51
sp|Q043V2|PFKA_LACGA ATP-dependent 6-phosphofructokinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=pfkA PE=3 SV=1 1 310 3.0E-51
sp|Q8R914|PFKA_CALS4 ATP-dependent 6-phosphofructokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pfkA PE=3 SV=1 1 341 3.0E-51
sp|B1L266|PFKA_CLOBM ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pfkA PE=3 SV=1 1 309 3.0E-51
sp|C3KV06|PFKA_CLOB6 ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pfkA PE=3 SV=1 1 309 3.0E-51
sp|A8AXW1|PFKA_STRGC ATP-dependent 6-phosphofructokinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pfkA PE=3 SV=1 1 338 3.0E-51
sp|Q8EPD6|PFKA_OCEIH ATP-dependent 6-phosphofructokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pfkA PE=3 SV=1 1 310 5.0E-51
sp|A1JHZ3|PFKA_YERE8 ATP-dependent 6-phosphofructokinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pfkA PE=3 SV=1 1 305 5.0E-51
sp|Q057P0|PFKA_BUCCC ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=pfkA PE=3 SV=1 1 342 6.0E-51
sp|Q9Z6C3|PFKA_ENTCL ATP-dependent 6-phosphofructokinase OS=Enterobacter cloacae GN=pfkA PE=3 SV=1 1 340 6.0E-51
sp|Q8DQ85|PFKA_STRR6 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pfkA PE=3 SV=1 1 349 9.0E-51
sp|Q04L24|PFKA_STRP2 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pfkA PE=3 SV=1 1 349 9.0E-51
sp|Q9RWN1|PFKA_DEIRA ATP-dependent 6-phosphofructokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pfkA PE=3 SV=2 1 343 1.0E-50
sp|P43863|PFKA_HAEIN ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pfkA PE=3 SV=1 1 345 2.0E-50
sp|A5UD89|PFKA_HAEIE ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain PittEE) GN=pfkA PE=3 SV=1 1 345 2.0E-50
sp|B5FBT1|PFKA_VIBFM ATP-dependent 6-phosphofructokinase OS=Vibrio fischeri (strain MJ11) GN=pfkA PE=3 SV=1 1 340 2.0E-50
sp|Q5E2B1|PFKA_VIBF1 ATP-dependent 6-phosphofructokinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pfkA PE=3 SV=1 1 340 2.0E-50
sp|Q2SSQ6|PFKA_MYCCT ATP-dependent 6-phosphofructokinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pfkA PE=3 SV=1 1 341 2.0E-50
sp|Q1LTT2|PFKA_BAUCH ATP-dependent 6-phosphofructokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pfkA PE=3 SV=1 1 310 2.0E-50
sp|Q4QLS8|PFKA_HAEI8 ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain 86-028NP) GN=pfkA PE=3 SV=1 1 345 2.0E-50
sp|C4LEQ5|PFKA_TOLAT ATP-dependent 6-phosphofructokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pfkA PE=3 SV=1 1 340 2.0E-50
sp|A6VM63|PFKA_ACTSZ ATP-dependent 6-phosphofructokinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pfkA PE=3 SV=1 1 340 2.0E-50
sp|Q9CPH2|PFKA_PASMU ATP-dependent 6-phosphofructokinase OS=Pasteurella multocida (strain Pm70) GN=pfkA PE=3 SV=1 1 340 3.0E-50
sp|C0MGJ9|PFKA_STRS7 ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pfkA PE=3 SV=1 1 338 3.0E-50
sp|A6TVD3|PFKA_ALKMQ ATP-dependent 6-phosphofructokinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=pfkA PE=3 SV=1 1 310 3.0E-50
sp|B4U2M2|PFKA_STREM ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=pfkA PE=3 SV=1 1 338 3.0E-50
sp|C0M8V6|PFKA_STRE4 ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. equi (strain 4047) GN=pfkA PE=3 SV=1 1 338 3.0E-50
sp|B8D7J8|PFKA_BUCAT ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pfkA PE=3 SV=1 1 340 3.0E-50
sp|P57391|PFKA_BUCAI ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pfkA PE=3 SV=1 1 340 3.0E-50
sp|B8D996|PFKA_BUCA5 ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pfkA PE=3 SV=1 1 340 3.0E-50
sp|Q5FKG6|PFKA_LACAC ATP-dependent 6-phosphofructokinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pfkA PE=3 SV=1 1 311 4.0E-50
sp|Q890Z2|PFKA_CLOTE ATP-dependent 6-phosphofructokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=pfkA PE=3 SV=1 1 336 4.0E-50
sp|Q8K9N0|PFKA_BUCAP ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pfkA PE=3 SV=1 1 342 4.0E-50
sp|Q30T53|PFKA_SULDN ATP-dependent 6-phosphofructokinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pfkA PE=3 SV=1 1 319 5.0E-50
sp|Q836R3|PFKA_ENTFA ATP-dependent 6-phosphofructokinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pfkA PE=3 SV=1 1 340 6.0E-50
sp|B5XLV6|PFKA_STRPZ ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q48T86|PFKA_STRPM ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|A2RE65|PFKA_STRPG ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q1JGH6|PFKA_STRPD ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q1JLD9|PFKA_STRPC ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q1JBF7|PFKA_STRPB ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q8P0S6|PFKA_STRP8 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q5XBV2|PFKA_STRP6 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|P0DD03|PFKA_STRPQ ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|P0DD02|PFKA_STRP3 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pfkA PE=3 SV=1 1 338 7.0E-50
sp|Q11RE2|PFKA_CYTH3 ATP-dependent 6-phosphofructokinase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pfkA PE=3 SV=1 2 342 1.0E-49
sp|Q99ZD0|PFKA_STRP1 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M1 GN=pfkA PE=3 SV=1 1 338 2.0E-49
sp|A8MLY0|PFKA_ALKOO ATP-dependent 6-phosphofructokinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=pfkA PE=3 SV=1 1 310 4.0E-49
sp|C0QQX4|PFKA_PERMH ATP-dependent 6-phosphofructokinase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=pfkA PE=3 SV=1 1 332 5.0E-49
sp|Q1J694|PFKA_STRPF ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pfkA PE=3 SV=1 3 338 5.0E-49
sp|A8YV22|PFKA_LACH4 ATP-dependent 6-phosphofructokinase OS=Lactobacillus helveticus (strain DPC 4571) GN=pfkA PE=3 SV=1 1 311 6.0E-49
sp|Q8RQN5|PFKA_COREF ATP-dependent 6-phosphofructokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pfkA PE=3 SV=1 1 342 7.0E-49
sp|Q65VM6|PFKA_MANSM ATP-dependent 6-phosphofructokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pfkA PE=3 SV=1 1 340 1.0E-48
sp|Q93LR4|PFKA_LYSSH ATP-dependent 6-phosphofructokinase OS=Lysinibacillus sphaericus GN=pfkA PE=3 SV=1 1 311 3.0E-48
sp|B9DSA4|PFKA_STRU0 ATP-dependent 6-phosphofructokinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pfkA PE=3 SV=1 1 338 4.0E-48
sp|O67605|PFKA_AQUAE ATP-dependent 6-phosphofructokinase OS=Aquifex aeolicus (strain VF5) GN=pfkA PE=3 SV=1 1 309 6.0E-48
sp|P65697|PFKA_STRA5 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pfkA PE=3 SV=1 1 338 7.0E-48
sp|P65696|PFKA_STRA3 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pfkA PE=3 SV=1 1 338 7.0E-48
sp|Q3K1E6|PFKA_STRA1 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pfkA PE=3 SV=1 1 338 7.0E-48
sp|Q88VY1|PFKA_LACPL ATP-dependent 6-phosphofructokinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pfkA PE=3 SV=1 1 347 1.0E-47
sp|Q8NR14|PFKA_CORGL ATP-dependent 6-phosphofructokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pfkA PE=3 SV=1 1 342 1.0E-47
sp|B0UW05|PFKA_HISS2 ATP-dependent 6-phosphofructokinase OS=Histophilus somni (strain 2336) GN=pfkA PE=3 SV=1 1 340 1.0E-47
sp|Q0I267|PFKA_HAES1 ATP-dependent 6-phosphofructokinase OS=Haemophilus somnus (strain 129Pt) GN=pfkA PE=3 SV=1 1 340 1.0E-47
sp|Q9FC99|PFKA3_STRCO ATP-dependent 6-phosphofructokinase 3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA3 PE=3 SV=1 1 308 2.0E-47
sp|Q7VRK9|PFKA_BLOFL ATP-dependent 6-phosphofructokinase OS=Blochmannia floridanus GN=pfkA PE=3 SV=1 1 337 2.0E-47
sp|Q9L9E3|PFKA_STRTR ATP-dependent 6-phosphofructokinase OS=Streptococcus thermophilus GN=pfkA PE=3 SV=1 1 338 2.0E-47
sp|Q03KB7|PFKA_STRTD ATP-dependent 6-phosphofructokinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pfkA PE=3 SV=1 1 338 2.0E-47
sp|Q8GNC1|PFKA_HAEDU ATP-dependent 6-phosphofructokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pfkA PE=3 SV=1 1 305 2.0E-47
sp|Q8DTX6|PFKA_STRMU ATP-dependent 6-phosphofructokinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pfkA PE=3 SV=1 1 338 4.0E-47
sp|Q8XL57|PFKA2_CLOPE ATP-dependent 6-phosphofructokinase 2 OS=Clostridium perfringens (strain 13 / Type A) GN=pfkA2 PE=3 SV=1 1 342 7.0E-47
sp|B0BQ64|PFKA_ACTPJ ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pfkA PE=3 SV=1 1 340 8.0E-47
sp|B3GY11|PFKA_ACTP7 ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pfkA PE=3 SV=1 1 340 8.0E-47
sp|A3N1C8|PFKA_ACTP2 ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pfkA PE=3 SV=1 1 340 8.0E-47
sp|Q02YK5|PFKA_LACLS ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pfkA PE=3 SV=1 1 338 1.0E-46
sp|A2RKA2|PFKA_LACLM ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pfkA PE=3 SV=1 1 338 1.0E-46
sp|Q07636|PFKA_LACLA ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pfkA PE=1 SV=1 1 338 1.0E-46
sp|Q6KHX0|PFKA_MYCMO ATP-dependent 6-phosphofructokinase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=pfkA PE=3 SV=1 1 337 2.0E-46
sp|O08333|PFP_STRCO Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA1 PE=3 SV=1 1 346 2.0E-46
sp|P9WID7|PFKA_MYCTU ATP-dependent 6-phosphofructokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pfkA PE=1 SV=1 1 342 4.0E-46
sp|P9WID6|PFKA_MYCTO ATP-dependent 6-phosphofructokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pfkA PE=3 SV=1 1 342 4.0E-46
sp|P65691|PFKA_MYCBO ATP-dependent 6-phosphofructokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pfkA PE=3 SV=1 1 342 4.0E-46
sp|Q59126|PFP_AMYME Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Amycolatopsis methanolica GN=pfp PE=1 SV=2 1 342 8.0E-46
sp|Q8RG98|PFKA_FUSNN ATP-dependent 6-phosphofructokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pfkA PE=3 SV=2 1 335 9.0E-46
sp|B8F8G9|PFKA_HAEPS ATP-dependent 6-phosphofructokinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pfkA PE=3 SV=1 1 340 1.0E-45
sp|C0Z7W7|PFKA_BREBN ATP-dependent 6-phosphofructokinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pfkA PE=3 SV=1 1 346 2.0E-45
sp|P59563|PFKA_BUCBP ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pfkA PE=3 SV=1 1 340 5.0E-45
sp|Q9AGC0|PFP_AMYMS Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Amycolatopsis mediterranei (strain S699) GN=pfp PE=3 SV=1 1 342 1.0E-44
sp|Q9L1L8|PFKA2_STRCO ATP-dependent 6-phosphofructokinase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA2 PE=1 SV=1 1 342 2.0E-44
sp|O33106|PFKA_MYCLE ATP-dependent 6-phosphofructokinase OS=Mycobacterium leprae (strain TN) GN=pfkA PE=3 SV=2 1 342 5.0E-44
sp|B8GAA4|PFKA_CHLAD ATP-dependent 6-phosphofructokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pfkA PE=3 SV=1 1 301 7.0E-44
sp|Q83EH9|PFKA_COXBU ATP-dependent 6-phosphofructokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pfkA PE=3 SV=1 1 332 9.0E-44
sp|A6QAB4|PFKA_SULNB ATP-dependent 6-phosphofructokinase OS=Sulfurovum sp. (strain NBC37-1) GN=pfkA PE=3 SV=1 1 319 2.0E-43
sp|Q98PW8|PFKA_MYCPU ATP-dependent 6-phosphofructokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=pfkA PE=3 SV=1 1 336 3.0E-43
sp|B3WE64|PFKA_LACCB ATP-dependent 6-phosphofructokinase OS=Lactobacillus casei (strain BL23) GN=pfkA PE=3 SV=1 1 327 5.0E-43
sp|Q039I0|PFKA_LACC3 ATP-dependent 6-phosphofructokinase OS=Lactobacillus casei (strain ATCC 334) GN=pfkA PE=3 SV=1 1 327 5.0E-43
sp|B9LHK4|PFKA_CHLSY ATP-dependent 6-phosphofructokinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pfkA PE=3 SV=1 1 301 1.0E-42
sp|A9WCU2|PFKA_CHLAA ATP-dependent 6-phosphofructokinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pfkA PE=3 SV=1 1 301 1.0E-42
sp|E0RTD9|PFKA_SPITD ATP-dependent 6-phosphofructokinase OS=Spirochaeta thermophila (strain ATCC 49972 / DSM 6192 / RI 19.B1) GN=pfkA PE=3 SV=1 1 342 8.0E-42
sp|Q7M9C2|PFKA_WOLSU ATP-dependent 6-phosphofructokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=pfkA PE=3 SV=1 1 327 1.0E-41
sp|Q8A2E9|PFKA3_BACTN ATP-dependent 6-phosphofructokinase 3 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA3 PE=3 SV=1 1 308 1.0E-39
sp|B1L9U3|PFKA_THESQ ATP-dependent 6-phosphofructokinase OS=Thermotoga sp. (strain RQ2) GN=pfkA PE=3 SV=1 389 740 5.0E-38
sp|P20275|PFKA_SPICI ATP-dependent 6-phosphofructokinase OS=Spiroplasma citri GN=pfkA PE=3 SV=2 1 353 7.0E-38
sp|A5IKL2|PFKA_THEP1 ATP-dependent 6-phosphofructokinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pfkA PE=3 SV=1 389 740 1.0E-37
sp|Q9KH71|PFP_DICTH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Dictyoglomus thermophilum GN=pfp PE=1 SV=1 1 345 1.0E-37
sp|Q9WY52|PFKA_THEMA ATP-dependent 6-phosphofructokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pfkA PE=1 SV=1 389 740 6.0E-37
sp|B9K6R9|PFKA_THENN ATP-dependent 6-phosphofructokinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pfkA PE=3 SV=1 389 740 2.0E-36
sp|Q601D3|PFKA_MYCH2 ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain 232) GN=pfkA PE=3 SV=1 1 308 2.0E-36
sp|Q4A8Q3|PFKA_MYCH7 ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain 7448) GN=pfkA PE=3 SV=1 1 308 2.0E-36
sp|Q4AAM2|PFKA_MYCHJ ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=pfkA PE=3 SV=1 1 308 3.0E-36
sp|Q8YKG3|PFKA1_NOSS1 ATP-dependent 6-phosphofructokinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pfkA1 PE=3 SV=1 1 342 1.0E-35
sp|P75476|PFKA_MYCPN Probable ATP-dependent 6-phosphofructokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pfkA PE=3 SV=1 1 286 4.0E-34
sp|G4RK16|PFP_THETK Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=pfp PE=1 SV=1 1 343 5.0E-34
sp|Q55988|PFKA2_SYNY3 ATP-dependent 6-phosphofructokinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pfkA2 PE=3 SV=1 1 341 3.0E-32
sp|Q8A8R5|PFKA1_BACTN ATP-dependent 6-phosphofructokinase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA1 PE=3 SV=1 390 719 5.0E-32
sp|Q8DJB1|PFKA_THEEB ATP-dependent 6-phosphofructokinase OS=Thermosynechococcus elongatus (strain BP-1) GN=pfkA PE=3 SV=1 1 312 5.0E-32
sp|Q3M8N2|PFKA_ANAVT ATP-dependent 6-phosphofructokinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pfkA PE=3 SV=1 1 310 5.0E-31
sp|D7GCU5|PFKA_PROFC ATP-dependent 6-phosphofructokinase OS=Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / CIP 103027 / CIRM-BIA1) GN=pfkA PE=3 SV=1 1 301 7.0E-31
sp|B8D1K5|PFKA_HALOH ATP-dependent 6-phosphofructokinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=pfkA PE=3 SV=1 389 686 8.0E-31
sp|B2A6Y0|PFKA_NATTJ ATP-dependent 6-phosphofructokinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|B8DHH7|PFKA_LISMH ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|A0AJ20|PFKA_LISW6 ATP-dependent 6-phosphofructokinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|Q8Y6W0|PFKA_LISMO ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|Q71Z96|PFKA_LISMF ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|C1KVL8|PFKA_LISMC ATP-dependent 6-phosphofructokinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pfkA PE=3 SV=1 389 686 1.0E-30
sp|Q92BE4|PFKA_LISIN ATP-dependent 6-phosphofructokinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pfkA PE=3 SV=1 389 686 2.0E-30
sp|Q8YVR1|PFKA2_NOSS1 ATP-dependent 6-phosphofructokinase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pfkA2 PE=3 SV=1 1 310 2.0E-30
sp|Q5KWB1|PFKA_GEOKA ATP-dependent 6-phosphofructokinase OS=Geobacillus kaustophilus (strain HTA426) GN=pfkA PE=3 SV=1 389 686 4.0E-30
sp|B1L266|PFKA_CLOBM ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pfkA PE=3 SV=1 390 715 4.0E-30
sp|C3KV06|PFKA_CLOB6 ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pfkA PE=3 SV=1 390 715 4.0E-30
sp|A7GIW9|PFKA_CLOBL ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pfkA PE=3 SV=1 390 686 6.0E-30
sp|B1IFV9|PFKA_CLOBK ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Okra / Type B1) GN=pfkA PE=3 SV=1 390 686 6.0E-30
sp|C1FM55|PFKA_CLOBJ ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pfkA PE=3 SV=1 390 686 6.0E-30
sp|A5I798|PFKA_CLOBH ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pfkA PE=3 SV=1 390 686 6.0E-30
sp|A7FYW7|PFKA_CLOB1 ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pfkA PE=3 SV=1 390 686 6.0E-30
sp|Q8DQ85|PFKA_STRR6 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pfkA PE=3 SV=1 389 725 6.0E-30
sp|Q04L24|PFKA_STRP2 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pfkA PE=3 SV=1 389 725 6.0E-30
sp|Q6HCT3|PFKA_BACHK ATP-dependent 6-phosphofructokinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|Q633J8|PFKA_BACCZ ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ZK / E33L) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|B9J099|PFKA_BACCQ ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain Q1) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|Q4MVY3|PFKA_BACCE ATP-dependent 6-phosphofructokinase OS=Bacillus cereus GN=pfkA PE=1 SV=1 389 686 8.0E-30
sp|B7HRN9|PFKA_BACC7 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain AH187) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|C1EUU3|PFKA_BACC3 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain 03BB102) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|Q72ZD8|PFKA_BACC1 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|B7JRX2|PFKA_BACC0 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain AH820) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|Q81KZ0|PFKA_BACAN ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|A0RJJ6|PFKA_BACAH ATP-dependent 6-phosphofructokinase OS=Bacillus thuringiensis (strain Al Hakam) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|C3L8X8|PFKA_BACAC ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|C3PAI8|PFKA_BACAA ATP-dependent 6-phosphofructokinase OS=Bacillus anthracis (strain A0248) GN=pfkA PE=3 SV=1 389 686 8.0E-30
sp|Q8EVH2|PFKA_MYCPE Probable ATP-dependent 6-phosphofructokinase OS=Mycoplasma penetrans (strain HF-2) GN=pfkA PE=3 SV=1 1 336 9.0E-30
sp|Q8A624|PFKA2_BACTN ATP-dependent 6-phosphofructokinase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA2 PE=3 SV=1 390 733 1.0E-29
sp|Q5WEF6|PFKA_BACSK ATP-dependent 6-phosphofructokinase OS=Bacillus clausii (strain KSM-K16) GN=pfkA PE=3 SV=1 389 740 1.0E-29
sp|A8FG55|PFKA_BACP2 ATP-dependent 6-phosphofructokinase OS=Bacillus pumilus (strain SAFR-032) GN=pfkA PE=3 SV=1 389 686 1.0E-29
sp|A9VJR1|PFKA_BACWK ATP-dependent 6-phosphofructokinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pfkA PE=3 SV=1 389 686 1.0E-29
sp|P00512|PFKA_GEOSE ATP-dependent 6-phosphofructokinase OS=Geobacillus stearothermophilus GN=pfkA PE=1 SV=2 389 686 2.0E-29
sp|B7HFB3|PFKA_BACC4 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain B4264) GN=pfkA PE=3 SV=1 389 686 2.0E-29
sp|B7IJZ8|PFKA_BACC2 ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain G9842) GN=pfkA PE=3 SV=1 389 686 2.0E-29
sp|O67605|PFKA_AQUAE ATP-dependent 6-phosphofructokinase OS=Aquifex aeolicus (strain VF5) GN=pfkA PE=3 SV=1 388 686 2.0E-29
sp|C5D663|PFKA_GEOSW ATP-dependent 6-phosphofructokinase OS=Geobacillus sp. (strain WCH70) GN=pfkA PE=3 SV=1 389 686 4.0E-29
sp|Q72H98|PFKA_THET2 ATP-dependent 6-phosphofructokinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pfkA PE=3 SV=1 389 732 4.0E-29
sp|P21777|PFKA1_THET8 ATP-dependent 6-phosphofructokinase 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pfkA PE=1 SV=3 389 732 4.0E-29
sp|B2IP53|PFKA_STRPS ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain CGSP14) GN=pfkA PE=3 SV=1 389 725 4.0E-29
sp|Q817F3|PFKA_BACCR ATP-dependent 6-phosphofructokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pfkA PE=3 SV=1 389 686 5.0E-29
sp|C1CRZ7|PFKA_STRZT ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pfkA PE=3 SV=1 389 725 5.0E-29
sp|C1CJY4|PFKA_STRZP ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain P1031) GN=pfkA PE=3 SV=1 389 725 5.0E-29
sp|C1CDP4|PFKA_STRZJ ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain JJA) GN=pfkA PE=3 SV=1 389 725 5.0E-29
sp|Q97RC6|PFKA_STRPN ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pfkA PE=3 SV=1 389 725 5.0E-29
sp|B8ZNU0|PFKA_STRPJ ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pfkA PE=3 SV=1 389 725 5.0E-29
sp|P47457|PFKA_MYCGE Probable ATP-dependent 6-phosphofructokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pfkA PE=3 SV=1 1 286 5.0E-29
sp|A8AXW1|PFKA_STRGC ATP-dependent 6-phosphofructokinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pfkA PE=3 SV=1 389 687 6.0E-29
sp|A6QAB4|PFKA_SULNB ATP-dependent 6-phosphofructokinase OS=Sulfurovum sp. (strain NBC37-1) GN=pfkA PE=3 SV=1 389 688 7.0E-29
sp|Q7M9C2|PFKA_WOLSU ATP-dependent 6-phosphofructokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=pfkA PE=3 SV=1 388 686 8.0E-29
sp|A7GTP4|PFKA_BACCN ATP-dependent 6-phosphofructokinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pfkA PE=3 SV=1 389 686 1.0E-28
sp|O34529|PFKA_BACSU ATP-dependent 6-phosphofructokinase OS=Bacillus subtilis (strain 168) GN=pfkA PE=1 SV=1 389 686 1.0E-28
sp|Q65G82|PFKA_BACLD ATP-dependent 6-phosphofructokinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pfkA PE=3 SV=1 389 686 1.0E-28
sp|C0QQX4|PFKA_PERMH ATP-dependent 6-phosphofructokinase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=pfkA PE=3 SV=1 389 686 1.0E-28
sp|A3CM69|PFKA_STRSV ATP-dependent 6-phosphofructokinase OS=Streptococcus sanguinis (strain SK36) GN=pfkA PE=3 SV=1 389 725 2.0E-28
sp|Q03F74|PFKA_PEDPA ATP-dependent 6-phosphofructokinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=pfkA PE=3 SV=1 389 686 2.0E-28
sp|Q8EPD6|PFKA_OCEIH ATP-dependent 6-phosphofructokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pfkA PE=3 SV=1 389 688 2.0E-28
sp|Q88VY1|PFKA_LACPL ATP-dependent 6-phosphofructokinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pfkA PE=3 SV=1 389 686 2.0E-28
sp|B7GGT1|PFKA_ANOFW ATP-dependent 6-phosphofructokinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pfkA PE=3 SV=1 389 686 3.0E-28
sp|C5BNR1|PFKA_TERTT ATP-dependent 6-phosphofructokinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pfkA PE=3 SV=1 389 686 4.0E-28
sp|B1IB66|PFKA_STRPI ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pfkA PE=3 SV=1 389 725 4.0E-28
sp|C1C6M8|PFKA_STRP7 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae (strain 70585) GN=pfkA PE=3 SV=1 389 725 4.0E-28
sp|B5E3Z8|PFKA_STRP4 ATP-dependent 6-phosphofructokinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pfkA PE=3 SV=1 389 725 4.0E-28
sp|B9DN94|PFKA_STACT ATP-dependent 6-phosphofructokinase OS=Staphylococcus carnosus (strain TM300) GN=pfkA PE=3 SV=1 389 688 7.0E-28
sp|Q9K843|PFKA_BACHD ATP-dependent 6-phosphofructokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pfkA PE=3 SV=1 389 686 1.0E-27
sp|Q30T53|PFKA_SULDN ATP-dependent 6-phosphofructokinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pfkA PE=3 SV=1 389 686 1.0E-27
sp|A7Z7K6|PFKA_BACMF ATP-dependent 6-phosphofructokinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pfkA PE=3 SV=1 389 686 2.0E-27
sp|Q836R3|PFKA_ENTFA ATP-dependent 6-phosphofructokinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pfkA PE=3 SV=1 389 688 2.0E-27
sp|Q8GNC1|PFKA_HAEDU ATP-dependent 6-phosphofructokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pfkA PE=3 SV=1 385 690 2.0E-27
sp|P72830|PFKA1_SYNY3 ATP-dependent 6-phosphofructokinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pfkA1 PE=3 SV=1 1 342 2.0E-27
sp|O08308|PFKA_CLOAB ATP-dependent 6-phosphofructokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pfkA PE=3 SV=2 390 686 3.0E-27
sp|B2V7W7|PFKA_SULSY ATP-dependent 6-phosphofructokinase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pfkA PE=3 SV=1 389 686 3.0E-27
sp|Q8RG98|PFKA_FUSNN ATP-dependent 6-phosphofructokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pfkA PE=3 SV=2 389 721 5.0E-27
sp|O08333|PFP_STRCO Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA1 PE=3 SV=1 388 721 1.0E-26
sp|Q8DTX6|PFKA_STRMU ATP-dependent 6-phosphofructokinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pfkA PE=3 SV=1 389 719 2.0E-26
sp|B0BQ64|PFKA_ACTPJ ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pfkA PE=3 SV=1 385 686 2.0E-26
sp|B3GY11|PFKA_ACTP7 ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pfkA PE=3 SV=1 385 686 2.0E-26
sp|A3N1C8|PFKA_ACTP2 ATP-dependent 6-phosphofructokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pfkA PE=3 SV=1 385 686 2.0E-26
sp|C4LEQ5|PFKA_TOLAT ATP-dependent 6-phosphofructokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pfkA PE=3 SV=1 389 679 3.0E-26
sp|B5FBT1|PFKA_VIBFM ATP-dependent 6-phosphofructokinase OS=Vibrio fischeri (strain MJ11) GN=pfkA PE=3 SV=1 389 688 4.0E-26
sp|Q5E2B1|PFKA_VIBF1 ATP-dependent 6-phosphofructokinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pfkA PE=3 SV=1 389 688 4.0E-26
sp|B2UZX8|PFKA_CLOBA ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pfkA PE=3 SV=1 389 686 5.0E-26
sp|B6EMS4|PFKA_ALISL ATP-dependent 6-phosphofructokinase OS=Aliivibrio salmonicida (strain LFI1238) GN=pfkA PE=3 SV=1 389 679 5.0E-26
sp|B2TQR6|PFKA_CLOBB ATP-dependent 6-phosphofructokinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pfkA PE=3 SV=1 389 686 7.0E-26
sp|Q1WTT3|PFKA_LACS1 ATP-dependent 6-phosphofructokinase OS=Lactobacillus salivarius (strain UCC118) GN=pfkA PE=3 SV=1 389 686 8.0E-26
sp|Q7VRK9|PFKA_BLOFL ATP-dependent 6-phosphofructokinase OS=Blochmannia floridanus GN=pfkA PE=3 SV=1 389 693 9.0E-26
sp|Q180P4|PFKA_PEPD6 ATP-dependent 6-phosphofructokinase OS=Peptoclostridium difficile (strain 630) GN=pfkA PE=3 SV=1 390 693 1.0E-25
sp|A7MX59|PFKA_VIBCB ATP-dependent 6-phosphofructokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pfkA PE=3 SV=1 389 679 1.0E-25
sp|Q9KNP2|PFKA_VIBCH ATP-dependent 6-phosphofructokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pfkA PE=3 SV=2 389 679 1.0E-25
sp|Q99ZD0|PFKA_STRP1 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M1 GN=pfkA PE=3 SV=1 389 725 1.0E-25
sp|Q9RWN1|PFKA_DEIRA ATP-dependent 6-phosphofructokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pfkA PE=3 SV=2 389 728 2.0E-25
sp|Q11RE2|PFKA_CYTH3 ATP-dependent 6-phosphofructokinase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pfkA PE=3 SV=1 389 719 2.0E-25
sp|Q9L1L8|PFKA2_STRCO ATP-dependent 6-phosphofructokinase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA2 PE=1 SV=1 388 733 2.0E-25
sp|C5BC26|PFKA_EDWI9 ATP-dependent 6-phosphofructokinase OS=Edwardsiella ictaluri (strain 93-146) GN=pfkA PE=3 SV=1 389 686 3.0E-25
sp|Q8R914|PFKA_CALS4 ATP-dependent 6-phosphofructokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pfkA PE=3 SV=1 390 706 3.0E-25
sp|Q9Z6C3|PFKA_ENTCL ATP-dependent 6-phosphofructokinase OS=Enterobacter cloacae GN=pfkA PE=3 SV=1 389 686 3.0E-25
sp|Q93LR4|PFKA_LYSSH ATP-dependent 6-phosphofructokinase OS=Lysinibacillus sphaericus GN=pfkA PE=3 SV=1 389 691 3.0E-25
sp|P65697|PFKA_STRA5 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pfkA PE=3 SV=1 389 725 4.0E-25
sp|P65696|PFKA_STRA3 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pfkA PE=3 SV=1 389 725 4.0E-25
sp|Q3K1E6|PFKA_STRA1 ATP-dependent 6-phosphofructokinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pfkA PE=3 SV=1 389 725 4.0E-25
sp|B8F8G9|PFKA_HAEPS ATP-dependent 6-phosphofructokinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pfkA PE=3 SV=1 389 686 4.0E-25
sp|B5XLV6|PFKA_STRPZ ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q48T86|PFKA_STRPM ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|A2RE65|PFKA_STRPG ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q1JGH6|PFKA_STRPD ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q1JLD9|PFKA_STRPC ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q1JBF7|PFKA_STRPB ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q8P0S6|PFKA_STRP8 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q5XBV2|PFKA_STRP6 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|P0DD03|PFKA_STRPQ ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|P0DD02|PFKA_STRP3 ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pfkA PE=3 SV=1 389 725 5.0E-25
sp|Q8A2E9|PFKA3_BACTN ATP-dependent 6-phosphofructokinase 3 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pfkA3 PE=3 SV=1 388 691 5.0E-25
sp|Q6LVK2|PFKA_PHOPR ATP-dependent 6-phosphofructokinase OS=Photobacterium profundum GN=pfkA PE=3 SV=1 389 686 6.0E-25
sp|Q057P0|PFKA_BUCCC ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=pfkA PE=3 SV=1 389 686 7.0E-25
sp|A6TVD3|PFKA_ALKMQ ATP-dependent 6-phosphofructokinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=pfkA PE=3 SV=1 390 740 8.0E-25
sp|Q02YK5|PFKA_LACLS ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pfkA PE=3 SV=1 389 725 9.0E-25
sp|A2RKA2|PFKA_LACLM ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pfkA PE=3 SV=1 389 725 9.0E-25
sp|Q07636|PFKA_LACLA ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pfkA PE=1 SV=1 389 725 9.0E-25
sp|Q8XNH2|PFKA1_CLOPE ATP-dependent 6-phosphofructokinase 1 OS=Clostridium perfringens (strain 13 / Type A) GN=pfkA1 PE=3 SV=1 389 686 1.0E-24
sp|Q59214|PFKA_PAEMC ATP-dependent 6-phosphofructokinase OS=Paenibacillus macquariensis GN=pfkA PE=3 SV=1 389 729 1.0E-24
sp|Q87KX0|PFKA_VIBPA ATP-dependent 6-phosphofructokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pfkA PE=3 SV=1 389 679 1.0E-24
sp|Q9FC99|PFKA3_STRCO ATP-dependent 6-phosphofructokinase 3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pfkA3 PE=3 SV=1 388 691 1.0E-24
sp|Q7MGW6|PFKA_VIBVY ATP-dependent 6-phosphofructokinase OS=Vibrio vulnificus (strain YJ016) GN=pfkA PE=3 SV=2 389 686 2.0E-24
sp|Q8DCY1|PFKA_VIBVU ATP-dependent 6-phosphofructokinase OS=Vibrio vulnificus (strain CMCP6) GN=pfkA PE=3 SV=1 389 686 2.0E-24
sp|Q74JM8|PFKA_LACJO ATP-dependent 6-phosphofructokinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pfkA PE=3 SV=1 389 686 2.0E-24
sp|Q890Z2|PFKA_CLOTE ATP-dependent 6-phosphofructokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=pfkA PE=3 SV=1 389 686 2.0E-24
sp|Q1J694|PFKA_STRPF ATP-dependent 6-phosphofructokinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pfkA PE=3 SV=1 389 725 2.0E-24
sp|C0MGJ9|PFKA_STRS7 ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pfkA PE=3 SV=1 389 719 3.0E-24
sp|B4U2M2|PFKA_STREM ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=pfkA PE=3 SV=1 389 719 3.0E-24
sp|C0M8V6|PFKA_STRE4 ATP-dependent 6-phosphofructokinase OS=Streptococcus equi subsp. equi (strain 4047) GN=pfkA PE=3 SV=1 389 719 3.0E-24
sp|Q5FKG6|PFKA_LACAC ATP-dependent 6-phosphofructokinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pfkA PE=3 SV=1 389 688 4.0E-24
sp|A8YV22|PFKA_LACH4 ATP-dependent 6-phosphofructokinase OS=Lactobacillus helveticus (strain DPC 4571) GN=pfkA PE=3 SV=1 389 688 4.0E-24
sp|P59680|PFKA_YARLI ATP-dependent 6-phosphofructokinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFK1 PE=2 SV=2 355 683 5.0E-24
sp|B0K6L2|PFKA_THEPX ATP-dependent 6-phosphofructokinase OS=Thermoanaerobacter sp. (strain X514) GN=pfkA PE=3 SV=1 390 686 6.0E-24
sp|B0K7U7|PFKA_THEP3 ATP-dependent 6-phosphofructokinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pfkA PE=3 SV=1 390 686 6.0E-24
sp|A4VTS0|PFKA_STRSY ATP-dependent 6-phosphofructokinase OS=Streptococcus suis (strain 05ZYH33) GN=pfkA PE=3 SV=1 389 725 7.0E-24
sp|Q043V2|PFKA_LACGA ATP-dependent 6-phosphofructokinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=pfkA PE=3 SV=1 389 686 7.0E-24
sp|A7MQ83|PFKA_CROS8 ATP-dependent 6-phosphofructokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pfkA PE=3 SV=1 389 686 8.0E-24
sp|Q9L9E3|PFKA_STRTR ATP-dependent 6-phosphofructokinase OS=Streptococcus thermophilus GN=pfkA PE=3 SV=1 389 725 8.0E-24
sp|Q03KB7|PFKA_STRTD ATP-dependent 6-phosphofructokinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pfkA PE=3 SV=1 389 725 8.0E-24
sp|Q83EH9|PFKA_COXBU ATP-dependent 6-phosphofructokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pfkA PE=3 SV=1 389 687 9.0E-24
sp|P16861|PFKA1_YEAST ATP-dependent 6-phosphofructokinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK1 PE=1 SV=1 344 689 1.0E-23
sp|Q6GG08|PFKA_STAAR ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MRSA252) GN=pfkA PE=3 SV=1 389 741 1.0E-23
sp|P80019|PFKA_LACDE ATP-dependent 6-phosphofructokinase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pfkA PE=1 SV=2 389 686 1.0E-23
sp|B7LVC9|PFKA_ESCF3 ATP-dependent 6-phosphofructokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pfkA PE=3 SV=1 389 686 1.0E-23
sp|A8AL13|PFKA_CITK8 ATP-dependent 6-phosphofructokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pfkA PE=3 SV=1 389 690 1.0E-23
sp|A4WG81|PFKA_ENT38 ATP-dependent 6-phosphofructokinase OS=Enterobacter sp. (strain 638) GN=pfkA PE=3 SV=1 389 686 1.0E-23
sp|Q9HGZ1|PFKA1_ASPOR ATP-dependent 6-phosphofructokinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfkA PE=2 SV=1 387 744 2.0E-23
sp|Q8CS68|PFKA_STAES ATP-dependent 6-phosphofructokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pfkA PE=3 SV=2 389 726 2.0E-23
sp|Q5HNK6|PFKA_STAEQ ATP-dependent 6-phosphofructokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pfkA PE=3 SV=1 389 727 2.0E-23
sp|P65695|PFKA_STAAW ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MW2) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|A8Z2L4|PFKA_STAAT ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|Q6G8M8|PFKA_STAAS ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain MSSA476) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|P99165|PFKA_STAAN ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain N315) GN=pfkA PE=1 SV=1 389 741 2.0E-23
sp|P65694|PFKA_STAAM ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|A6QHN3|PFKA_STAAE ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain Newman) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|Q5HF75|PFKA_STAAC ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain COL) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|Q2YTE2|PFKA_STAAB ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|A5ITM2|PFKA_STAA9 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain JH9) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|Q2FXM8|PFKA_STAA8 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain NCTC 8325) GN=pfkA PE=1 SV=2 389 741 2.0E-23
sp|A6U2G5|PFKA_STAA2 ATP-dependent 6-phosphofructokinase OS=Staphylococcus aureus (strain JH1) GN=pfkA PE=3 SV=1 389 741 2.0E-23
sp|Q6CZ46|PFKA_PECAS ATP-dependent 6-phosphofructokinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pfkA PE=3 SV=1 389 687 2.0E-23
sp|B9DSA4|PFKA_STRU0 ATP-dependent 6-phosphofructokinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pfkA PE=3 SV=1 389 725 2.0E-23
sp|Q8FBD0|PFKA_ECOL6 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pfkA PE=3 SV=2 389 686 3.0E-23
sp|B7UNN6|PFKA_ECO27 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pfkA PE=3 SV=1 389 686 3.0E-23
sp|B2VF62|PFKA_ERWT9 ATP-dependent 6-phosphofructokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pfkA PE=3 SV=1 389 686 4.0E-23
sp|P65692|PFKA_SALTY ATP-dependent 6-phosphofructokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|P65693|PFKA_SALTI ATP-dependent 6-phosphofructokinase OS=Salmonella typhi GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B4TPS6|PFKA_SALSV ATP-dependent 6-phosphofructokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5BJI2|PFKA_SALPK ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|C0Q414|PFKA_SALPC ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi C (strain RKS4594) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|A9MZE7|PFKA_SALPB ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q5PIR6|PFKA_SALPA ATP-dependent 6-phosphofructokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B4T049|PFKA_SALNS ATP-dependent 6-phosphofructokinase OS=Salmonella newport (strain SL254) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B4TCK0|PFKA_SALHS ATP-dependent 6-phosphofructokinase OS=Salmonella heidelberg (strain SL476) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5QWZ5|PFKA_SALEP ATP-dependent 6-phosphofructokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5FPR2|PFKA_SALDC ATP-dependent 6-phosphofructokinase OS=Salmonella dublin (strain CT_02021853) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q57HF3|PFKA_SALCH ATP-dependent 6-phosphofructokinase OS=Salmonella choleraesuis (strain SC-B67) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|A9MI50|PFKA_SALAR ATP-dependent 6-phosphofructokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5F0P6|PFKA_SALA4 ATP-dependent 6-phosphofructokinase OS=Salmonella agona (strain SL483) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5RFA9|PFKA_SALG2 ATP-dependent 6-phosphofructokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q3YV62|PFKA_SHISS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella sonnei (strain Ss046) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|P0A798|PFKA_SHIFL ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella flexneri GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q32A80|PFKA_SHIDS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q31U74|PFKA_SHIBS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B2TVQ8|PFKA_SHIB3 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B1LNL9|PFKA_ECOSM ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B6I4Q8|PFKA_ECOSE ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain SE11) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7NFL3|PFKA_ECOLU ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|P0A796|PFKA_ECOLI ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12) GN=pfkA PE=1 SV=1 389 686 5.0E-23
sp|B1IVG3|PFKA_ECOLC ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|Q0TAE8|PFKA_ECOL5 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|A8A720|PFKA_ECOHS ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O9:H4 (strain HS) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B1XB82|PFKA_ECODH ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12 / DH10B) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|C5A083|PFKA_ECOBW ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7M6W7|PFKA_ECO8A ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O8 (strain IAI1) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7N2Q7|PFKA_ECO81 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O81 (strain ED1a) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7NU91|PFKA_ECO7I ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B5YZ53|PFKA_ECO5E ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|P0A797|PFKA_ECO57 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O157:H7 GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7LA13|PFKA_ECO55 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli (strain 55989 / EAEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|B7MI48|PFKA_ECO45 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|A7ZUC9|PFKA_ECO24 ATP-dependent 6-phosphofructokinase isozyme 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pfkA PE=3 SV=1 389 686 5.0E-23
sp|A8GLB0|PFKA_SERP5 ATP-dependent 6-phosphofructokinase OS=Serratia proteamaculans (strain 568) GN=pfkA PE=3 SV=1 389 686 7.0E-23
sp|Q2SSQ6|PFKA_MYCCT ATP-dependent 6-phosphofructokinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pfkA PE=3 SV=1 389 704 7.0E-23
sp|A0PYC8|PFKA_CLONN ATP-dependent 6-phosphofructokinase OS=Clostridium novyi (strain NT) GN=pfkA PE=3 SV=1 390 715 8.0E-23
sp|B3WE64|PFKA_LACCB ATP-dependent 6-phosphofructokinase OS=Lactobacillus casei (strain BL23) GN=pfkA PE=3 SV=1 389 686 8.0E-23
sp|Q039I0|PFKA_LACC3 ATP-dependent 6-phosphofructokinase OS=Lactobacillus casei (strain ATCC 334) GN=pfkA PE=3 SV=1 389 686 8.0E-23
sp|C6DHK2|PFKA_PECCP ATP-dependent 6-phosphofructokinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pfkA PE=3 SV=1 389 687 9.0E-23
sp|Q1LTT2|PFKA_BAUCH ATP-dependent 6-phosphofructokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pfkA PE=3 SV=1 389 686 1.0E-22
sp|A8MLY0|PFKA_ALKOO ATP-dependent 6-phosphofructokinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=pfkA PE=3 SV=1 389 715 1.0E-22
sp|P12382|PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus GN=Pfkl PE=1 SV=4 384 728 2.0E-22
sp|P30835|PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus GN=Pfkl PE=1 SV=3 384 728 2.0E-22
sp|B9E7A4|PFKA_MACCJ ATP-dependent 6-phosphofructokinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=pfkA PE=3 SV=1 389 731 2.0E-22
sp|A6TGB8|PFKA_KLEP7 ATP-dependent 6-phosphofructokinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pfkA PE=3 SV=1 389 686 2.0E-22
sp|B5XZ40|PFKA_KLEP3 ATP-dependent 6-phosphofructokinase OS=Klebsiella pneumoniae (strain 342) GN=pfkA PE=3 SV=1 389 686 2.0E-22
sp|O94201|PFKA1_CANAX ATP-dependent 6-phosphofructokinase subunit alpha OS=Candida albicans GN=PFK1 PE=1 SV=1 387 684 3.0E-22
sp|C4K7E1|PFKA_HAMD5 ATP-dependent 6-phosphofructokinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pfkA PE=3 SV=1 389 740 4.0E-22
sp|Q5R7V5|PFKAL_PONAB ATP-dependent 6-phosphofructokinase, liver type OS=Pongo abelii GN=PFKL PE=2 SV=1 390 686 5.0E-22
sp|Q4A8Q3|PFKA_MYCH7 ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain 7448) GN=pfkA PE=3 SV=1 389 684 5.0E-22
sp|P90521|PFKA_DICDI ATP-dependent 6-phosphofructokinase OS=Dictyostelium discoideum GN=pfkA PE=1 SV=2 389 751 7.0E-22
sp|Q4AAM2|PFKA_MYCHJ ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=pfkA PE=3 SV=1 389 684 7.0E-22
sp|A1JHZ3|PFKA_YERE8 ATP-dependent 6-phosphofructokinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pfkA PE=3 SV=1 389 736 8.0E-22
sp|Q8K9N0|PFKA_BUCAP ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pfkA PE=3 SV=1 389 686 9.0E-22
sp|Q03215|PFKA1_KLULA ATP-dependent 6-phosphofructokinase subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFK1 PE=1 SV=1 384 719 1.0E-21
sp|P9WID7|PFKA_MYCTU ATP-dependent 6-phosphofructokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pfkA PE=1 SV=1 388 691 1.0E-21
sp|P9WID6|PFKA_MYCTO ATP-dependent 6-phosphofructokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pfkA PE=3 SV=1 388 691 1.0E-21
sp|P65691|PFKA_MYCBO ATP-dependent 6-phosphofructokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pfkA PE=3 SV=1 388 691 1.0E-21
sp|Q9AGC0|PFP_AMYMS Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Amycolatopsis mediterranei (strain S699) GN=pfp PE=3 SV=1 388 733 1.0E-21
sp|B0S230|PFKA_FINM2 ATP-dependent 6-phosphofructokinase OS=Finegoldia magna (strain ATCC 29328) GN=pfkA PE=3 SV=1 390 685 2.0E-21
sp|A6VM63|PFKA_ACTSZ ATP-dependent 6-phosphofructokinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pfkA PE=3 SV=1 389 686 2.0E-21
sp|Q65VM6|PFKA_MANSM ATP-dependent 6-phosphofructokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pfkA PE=3 SV=1 389 686 2.0E-21
sp|Q601D3|PFKA_MYCH2 ATP-dependent 6-phosphofructokinase OS=Mycoplasma hyopneumoniae (strain 232) GN=pfkA PE=3 SV=1 389 684 2.0E-21
sp|O42938|PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfk1 PE=1 SV=1 383 744 3.0E-21
sp|A4TSA7|PFKA_YERPP ATP-dependent 6-phosphofructokinase OS=Yersinia pestis (strain Pestoides F) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|Q1CD33|PFKA_YERPN ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|A9R6A3|PFKA_YERPG ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|Q8ZJL6|PFKA_YERPE ATP-dependent 6-phosphofructokinase OS=Yersinia pestis GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|Q1C297|PFKA_YERPA ATP-dependent 6-phosphofructokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|A7FCW1|PFKA_YERP3 ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|B1JQU4|PFKA_YERPY ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|Q66GA8|PFKA_YERPS ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|B2JZA3|PFKA_YERPB ATP-dependent 6-phosphofructokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pfkA PE=3 SV=1 389 736 3.0E-21
sp|Q59126|PFP_AMYME Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Amycolatopsis methanolica GN=pfp PE=1 SV=2 388 733 3.0E-21
sp|Q98PW8|PFKA_MYCPU ATP-dependent 6-phosphofructokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=pfkA PE=3 SV=1 389 735 3.0E-21
sp|Q9KH71|PFP_DICTH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Dictyoglomus thermophilum GN=pfp PE=1 SV=1 386 683 3.0E-21
sp|P52784|PFKAM_CANLF ATP-dependent 6-phosphofructokinase, muscle type OS=Canis lupus familiaris GN=PFKM PE=2 SV=2 390 728 7.0E-21
sp|Q867C9|PFKAM_HORSE ATP-dependent 6-phosphofructokinase, muscle type OS=Equus caballus GN=PFKM PE=2 SV=3 390 728 8.0E-21
sp|E0RTD9|PFKA_SPITD ATP-dependent 6-phosphofructokinase OS=Spirochaeta thermophila (strain ATCC 49972 / DSM 6192 / RI 19.B1) GN=pfkA PE=3 SV=1 390 734 8.0E-21
sp|Q4W9B8|PFKA_ASPFU ATP-dependent 6-phosphofructokinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfkA PE=3 SV=1 387 726 1.0E-20
sp|B8D7J8|PFKA_BUCAT ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pfkA PE=3 SV=1 389 720 1.0E-20
sp|P57391|PFKA_BUCAI ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pfkA PE=3 SV=1 389 720 1.0E-20
sp|B8D996|PFKA_BUCA5 ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pfkA PE=3 SV=1 389 720 1.0E-20
sp|Q6KHX0|PFKA_MYCMO ATP-dependent 6-phosphofructokinase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=pfkA PE=3 SV=1 389 719 1.0E-20
sp|P20275|PFKA_SPICI ATP-dependent 6-phosphofructokinase OS=Spiroplasma citri GN=pfkA PE=3 SV=2 389 686 1.0E-20
sp|P78985|PFKA_ASPNG ATP-dependent 6-phosphofructokinase OS=Aspergillus niger GN=pfkA PE=3 SV=1 387 719 2.0E-20
sp|Q2HYU2|PFKAM_PIG ATP-dependent 6-phosphofructokinase, muscle type OS=Sus scrofa GN=PFKM PE=2 SV=1 390 728 2.0E-20
sp|Q0IIG5|PFKAM_BOVIN ATP-dependent 6-phosphofructokinase, muscle type OS=Bos taurus GN=PFKM PE=2 SV=1 390 728 2.0E-20
sp|B8GAA4|PFKA_CHLAD ATP-dependent 6-phosphofructokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pfkA PE=3 SV=1 387 677 2.0E-20
sp|P17858|PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens GN=PFKL PE=1 SV=6 390 686 4.0E-20
sp|A1A4J1|PFKAL_BOVIN ATP-dependent 6-phosphofructokinase, liver type OS=Bos taurus GN=PFKL PE=2 SV=1 390 719 4.0E-20
sp|B9LHK4|PFKA_CHLSY ATP-dependent 6-phosphofructokinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pfkA PE=3 SV=1 387 677 4.0E-20
sp|A9WCU2|PFKA_CHLAA ATP-dependent 6-phosphofructokinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pfkA PE=3 SV=1 387 677 4.0E-20
sp|Q5R636|PFKAP_PONAB ATP-dependent 6-phosphofructokinase, platelet type OS=Pongo abelii GN=PFKP PE=2 SV=1 390 728 7.0E-20
sp|Q27778|PFKA_SCHMA ATP-dependent 6-phosphofructokinase OS=Schistosoma mansoni GN=PFK PE=1 SV=1 390 721 8.0E-20
sp|Q8NJU8|PFKA1_PICPA ATP-dependent 6-phosphofructokinase subunit alpha OS=Komagataella pastoris GN=PFK1 PE=1 SV=1 384 684 9.0E-20
sp|O33106|PFKA_MYCLE ATP-dependent 6-phosphofructokinase OS=Mycobacterium leprae (strain TN) GN=pfkA PE=3 SV=2 388 681 9.0E-20
sp|Q01813|PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens GN=PFKP PE=1 SV=2 390 728 1.0E-19
sp|B0UW05|PFKA_HISS2 ATP-dependent 6-phosphofructokinase OS=Histophilus somni (strain 2336) GN=pfkA PE=3 SV=1 389 747 1.0E-19
sp|Q0I267|PFKA_HAES1 ATP-dependent 6-phosphofructokinase OS=Haemophilus somnus (strain 129Pt) GN=pfkA PE=3 SV=1 389 747 1.0E-19
sp|Q92448|PFKA1_PICPG ATP-dependent 6-phosphofructokinase subunit alpha OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PFK1 PE=1 SV=2 384 684 2.0E-19
sp|P08237|PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens GN=PFKM PE=1 SV=2 390 728 2.0E-19
sp|Q60HD9|PFKAM_MACFA ATP-dependent 6-phosphofructokinase, muscle type OS=Macaca fascicularis GN=PFKM PE=2 SV=3 390 728 2.0E-19
sp|P00511|PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus GN=PFKM PE=1 SV=3 390 728 2.0E-19
sp|P47857|PFKAM_MOUSE ATP-dependent 6-phosphofructokinase, muscle type OS=Mus musculus GN=Pfkm PE=1 SV=3 390 728 2.0E-19
sp|P47858|PFKAM_RAT ATP-dependent 6-phosphofructokinase, muscle type OS=Rattus norvegicus GN=Pfkm PE=1 SV=3 390 686 2.0E-19
sp|Q2NQX2|PFKA_SODGM ATP-dependent 6-phosphofructokinase OS=Sodalis glossinidius (strain morsitans) GN=pfkA PE=3 SV=1 389 686 2.0E-19
sp|P16862|PFKA2_YEAST ATP-dependent 6-phosphofructokinase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK2 PE=1 SV=4 370 684 3.0E-19
sp|P47860|PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus GN=Pfkp PE=1 SV=2 390 728 3.0E-19
sp|P43863|PFKA_HAEIN ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pfkA PE=3 SV=1 389 678 3.0E-19
sp|A5UD89|PFKA_HAEIE ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain PittEE) GN=pfkA PE=3 SV=1 389 678 3.0E-19
sp|O94200|PFKA2_CANAX ATP-dependent 6-phosphofructokinase subunit beta OS=Candida albicans GN=PFK2 PE=1 SV=1 387 686 4.0E-19
sp|Q4QLS8|PFKA_HAEI8 ATP-dependent 6-phosphofructokinase OS=Haemophilus influenzae (strain 86-028NP) GN=pfkA PE=3 SV=1 389 678 4.0E-19
sp|Q9HGZ0|PFKA2_ASPOR ATP-dependent 6-phosphofructokinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfkB PE=2 SV=1 389 684 5.0E-19
sp|Q9WUA3|PFKAP_MOUSE ATP-dependent 6-phosphofructokinase, platelet type OS=Mus musculus GN=Pfkp PE=1 SV=1 390 728 5.0E-19
sp|Q9CPH2|PFKA_PASMU ATP-dependent 6-phosphofructokinase OS=Pasteurella multocida (strain Pm70) GN=pfkA PE=3 SV=1 389 686 7.0E-19
sp|Q5RAG9|PFKAM_PONAB ATP-dependent 6-phosphofructokinase, muscle type OS=Pongo abelii GN=PFKM PE=2 SV=1 390 728 9.0E-19
sp|C4QXA5|PFKA2_PICPG ATP-dependent 6-phosphofructokinase subunit beta OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PFK2 PE=3 SV=2 381 684 1.0E-18
sp|Q8TGA0|PFKA2_PICPA ATP-dependent 6-phosphofructokinase subunit beta OS=Komagataella pastoris GN=PFK2 PE=1 SV=1 381 684 1.0E-18
sp|P59563|PFKA_BUCBP ATP-dependent 6-phosphofructokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pfkA PE=3 SV=1 389 678 1.0E-18
sp|P47859|PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus GN=PFKP PE=1 SV=1 390 686 3.0E-18
sp|Q27483|PFKA2_CAEEL ATP-dependent 6-phosphofructokinase 2 OS=Caenorhabditis elegans GN=C50F4.2 PE=3 SV=1 379 686 4.0E-18
sp|Q9PQV8|PFKA_UREPA Probable ATP-dependent 6-phosphofructokinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=pfkA PE=3 SV=1 1 297 4.0E-18
sp|G4RK16|PFP_THETK Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=pfp PE=1 SV=1 388 688 5.0E-18
sp|Q03216|PFKA2_KLULA ATP-dependent 6-phosphofructokinase subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFK2 PE=1 SV=2 385 684 6.0E-18
sp|Q8YVR1|PFKA2_NOSS1 ATP-dependent 6-phosphofructokinase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pfkA2 PE=3 SV=1 387 675 9.0E-18
sp|Q8DJB1|PFKA_THEEB ATP-dependent 6-phosphofructokinase OS=Thermosynechococcus elongatus (strain BP-1) GN=pfkA PE=3 SV=1 384 675 1.0E-17
sp|Q8EVH2|PFKA_MYCPE Probable ATP-dependent 6-phosphofructokinase OS=Mycoplasma penetrans (strain HF-2) GN=pfkA PE=3 SV=1 389 697 1.0E-17
sp|C0Z7W7|PFKA_BREBN ATP-dependent 6-phosphofructokinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pfkA PE=3 SV=1 389 686 2.0E-17
sp|Q8NR14|PFKA_CORGL ATP-dependent 6-phosphofructokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pfkA PE=3 SV=1 388 682 3.0E-17
sp|Q8YKG3|PFKA1_NOSS1 ATP-dependent 6-phosphofructokinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pfkA1 PE=3 SV=1 385 687 3.0E-17
sp|Q27651|PFKA_ENTHI ATP-dependent 6-phosphofructokinase OS=Entamoeba histolytica GN=PPi-PFK PE=1 SV=2 1 262 2.0E-16
sp|Q3M8N2|PFKA_ANAVT ATP-dependent 6-phosphofructokinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pfkA PE=3 SV=1 387 726 3.0E-16
sp|Q8RQN5|PFKA_COREF ATP-dependent 6-phosphofructokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pfkA PE=3 SV=1 388 682 5.0E-16
sp|Q9WYC5|PFP_THEMA Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pfp PE=1 SV=1 1 262 5.0E-16
sp|Q8VYN6|PFKA5_ARATH ATP-dependent 6-phosphofructokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PFK5 PE=1 SV=1 1 246 2.0E-12
sp|Q8VU09|PFKA_AMYME ATP-dependent 6-phosphofructokinase OS=Amycolatopsis methanolica GN=pfkA PE=1 SV=1 1 246 6.0E-12
sp|Q9BIC6|PFKA_LEIDO ATP-dependent 6-phosphofructokinase OS=Leishmania donovani GN=pfk PE=1 SV=1 1 245 3.0E-11
sp|Q27705|PFP_NAEFO Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Naegleria fowleri PE=1 SV=1 1 245 3.0E-11
sp|P72830|PFKA1_SYNY3 ATP-dependent 6-phosphofructokinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pfkA1 PE=3 SV=1 389 672 6.0E-11
sp|O83146|PFKA_TREPA ATP-dependent 6-phosphofructokinase OS=Treponema pallidum (strain Nichols) GN=pfkA PE=3 SV=1 1 246 2.0E-10
sp|Q9C5J7|PFKA7_ARATH ATP-dependent 6-phosphofructokinase 7 OS=Arabidopsis thaliana GN=PFK7 PE=1 SV=1 1 246 3.0E-10
sp|P75476|PFKA_MYCPN Probable ATP-dependent 6-phosphofructokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pfkA PE=3 SV=1 382 697 4.0E-10
sp|A2EF58|PFP3_TRIVA Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 3 (Fragment) OS=Trichomonas vaginalis GN=pfk3 PE=1 SV=2 1 253 4.0E-10
sp|Q8XL57|PFKA2_CLOPE ATP-dependent 6-phosphofructokinase 2 OS=Clostridium perfringens (strain 13 / Type A) GN=pfkA2 PE=3 SV=1 389 684 6.0E-10
sp|Q8WPP2|PFKA_TRYBO ATP-dependent 6-phosphofructokinase OS=Trypanoplasma borreli GN=pfk PE=3 SV=1 1 283 8.0E-10
sp|O61068|PFP1_TRIVA Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 1 OS=Trichomonas vaginalis GN=Pfk1 PE=1 SV=1 1 253 8.0E-10
sp|A2E9H3|PFP2_TRIVA Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 2 OS=Trichomonas vaginalis GN=pfk2 PE=1 SV=1 1 253 2.0E-09
sp|D7GCU5|PFKA_PROFC ATP-dependent 6-phosphofructokinase OS=Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / CIP 103027 / CIRM-BIA1) GN=pfkA PE=3 SV=1 388 678 9.0E-09
sp|Q4E657|PFKA_TRYCC ATP-dependent 6-phosphofructokinase OS=Trypanosoma cruzi (strain CL Brener) GN=pfk PE=1 SV=1 1 245 1.0E-08
sp|Q9FIK0|PFKA2_ARATH ATP-dependent 6-phosphofructokinase 2 OS=Arabidopsis thaliana GN=PFK2 PE=1 SV=1 1 246 2.0E-08
sp|O15648|PFKA_TRYBB ATP-dependent 6-phosphofructokinase OS=Trypanosoma brucei brucei GN=pfk PE=1 SV=1 1 335 4.0E-08
sp|Q94AA4|PFKA3_ARATH ATP-dependent 6-phosphofructokinase 3 OS=Arabidopsis thaliana GN=PFK3 PE=1 SV=1 1 267 4.0E-08
sp|Q9M0F9|PFKA1_ARATH ATP-dependent 6-phosphofructokinase 1 OS=Arabidopsis thaliana GN=PFK1 PE=1 SV=1 1 261 5.0E-08
sp|Q9WYC5|PFP_THEMA Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pfp PE=1 SV=1 389 598 6.0E-08
sp|Q55988|PFKA2_SYNY3 ATP-dependent 6-phosphofructokinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pfkA2 PE=3 SV=1 389 687 7.0E-08
sp|Q9M076|PFKA6_ARATH ATP-dependent 6-phosphofructokinase 6 OS=Arabidopsis thaliana GN=PFK6 PE=1 SV=1 1 246 7.0E-08
sp|Q9FKG3|PFKA4_ARATH ATP-dependent 6-phosphofructokinase 4, chloroplastic OS=Arabidopsis thaliana GN=PFK4 PE=1 SV=1 1 246 8.0E-08
sp|O51669|PFKA_BORBU ATP-dependent 6-phosphofructokinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pfkA PE=3 SV=2 2 342 1.0E-07
sp|Q8VYN6|PFKA5_ARATH ATP-dependent 6-phosphofructokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PFK5 PE=1 SV=1 383 641 2.0E-07
sp|Q27705|PFP_NAEFO Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Naegleria fowleri PE=1 SV=1 390 593 2.0E-07
sp|Q27543|PFKA_CALFI ATP-dependent 6-phosphofructokinase (Fragment) OS=Calanus finmarchicus GN=PFK PE=2 SV=1 515 662 3.0E-07
sp|P29495|PFP_PROFC Pyrophosphate--fructose 6-phosphate 1-phosphotransferase OS=Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / CIP 103027 / CIRM-BIA1) GN=pfp PE=1 SV=2 1 196 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003872 6-phosphofructokinase activity Yes
GO:0006096 glycolytic process Yes
GO:0009056 catabolic process No
GO:0006082 organic acid metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046939 nucleotide phosphorylation No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0016052 carbohydrate catabolic process No
GO:0006757 ATP generation from ADP No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016310 phosphorylation No
GO:0043436 oxoacid metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0046031 ADP metabolic process No
GO:0008152 metabolic process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009259 ribonucleotide metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0008150 biological_process No
GO:0008443 phosphofructokinase activity No
GO:0032787 monocarboxylic acid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0046034 ATP metabolic process No
GO:0019200 carbohydrate kinase activity No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003674 molecular_function No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0006090 pyruvate metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009117 nucleotide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1449
Ophiocordyceps australis map64 (Brazil) OphauB2|5098
Ophiocordyceps camponoti-floridani Ophcf2|00784
Ophiocordyceps camponoti-rufipedis Ophun1|5260 (this protein)
Ophiocordyceps kimflemingae Ophio5|2608
Ophiocordyceps subramaniannii Hirsu2|10679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5260
MTSGGDSPGMNGVVRAVVRMAIHMGCDAYAVYEGYEGLVRGGDLIKQMEWHDVRGWLSEGGTLVGTARCMAFYER
PGRLAAAKNMVLQGIDALIICGGDGSLTGADRFRSEWPSLLAELVKKGELSKFQVKPYEHLNIVGIVGSIDNDLS
GTDATIGCYSALSRICEMVDYIEATASSHSRAFVIEVMGRHCGWLALLAGVATGADFVFIPERPQDSDWRHEMSD
VVRRHRTLGKRKTIVIVAEGARDKDGAKIHPEAIKDLLSDKGEGCLGLDTRITTLGHVQRGGTAVAYDRTLATLQ
GVEAVKAVLEATPETETCFIAITENKIVRKPLMQAVKETKEVAAAVEAKEFDRAMSLRDTEFADQYRSYLTTTNV
FAGDRKLPEKSRMKIGFINVGAPAGGMNAAVRAAVAYCLSRGHDPIAIHNGFAGFARHHDDKPLGAVRPFDWLEV
DGWASKGGSEIGTNRELPSESGMELIANLIEQYQFDALFIVGGFEAFHSISQLRKARDEYPSLCIPICLLPATIS
NNVPGTEYSLGSDTCLNELVHYCDKIKQSASATRRRVFVIETQGGRSGYVATLSGLNVGASAVYIPEEGISLEML
NADVKHLKEVFRKDTGQSRAGRVILVNEKASKVYDAKLIAKIIREEAHDRFESRESIPGHVQQGGVPSPMDRCRA
VRLAIKCIQHLEDFGRNAHNRVKKDPNSTTVIGIQGTEVVFTPMKKLEEESTDWPNRRPKFAYWLHMREVVDILG
GRPDYPRPEKSLEGLLAKDTKRGIAVDS*
Coding >Ophun1|5260
ATGACCTCCGGCGGGGACTCCCCGGGCATGAACGGCGTTGTCCGGGCCGTCGTCCGTATGGCCATACACATGGGA
TGTGATGCCTACGCTGTCTACGAGGGCTACGAAGGGCTCGTCCGCGGCGGCGACCTCATCAAGCAGATGGAGTGG
CACGATGTGCGTGGCTGGCTGTCTGAAGGCGGGACCCTCGTTGGTACTGCGCGCTGCATGGCCTTTTACGAGCGT
CCCGGTCGCCTGGCTGCGGCCAAGAACATGGTTCTCCAGGGCATCGACGCCCTCATCATCTGCGGTGGTGATGGT
TCGCTCACGGGTGCCGACCGCTTCCGCTCCGAATGGCCCTCTCTCCTGGCCGAGCTTGTCAAAAAGGGCGAGCTT
TCCAAGTTTCAGGTCAAGCCCTACGAGCACCTAAACATTGTAGGCATCGTTGGCTCCATCGACAACGACCTCTCC
GGAACCGATGCCACCATCGGCTGCTACTCGGCCCTCTCTCGAATCTGCGAAATGGTCGACTACATCGAGGCCACG
GCGTCGTCGCACTCGCGAGCCTTTGTCATCGAAGTCATGGGTCGTCACTGCGGCTGGCTAGCTCTTCTCGCCGGT
GTGGCTACAGGTGCCGACTTCGTCTTCATCCCCGAACGCCCGCAGGACTCGGACTGGCGCCATGAAATGTCTGAC
GTCGTTCGCAGGCATCGGACGCTAGGAAAGCGCAAGACCATCGTCATCGTCGCCGAGGGAGCCCGCGACAAGGAC
GGGGCCAAGATCCATCCCGAGGCCATCAAAGATCTGCTGTCTGACAAGGGTGAAGGATGCCTGGGCCTCGACACA
CGTATCACGACGCTCGGCCATGTGCAGCGCGGTGGCACCGCCGTCGCCTACGATCGTACGCTGGCCACACTGCAG
GGAGTCGAGGCCGTCAAAGCCGTACTCGAGGCAACGCCTGAAACGGAGACGTGCTTTATCGCCATTACCGAGAAT
AAGATTGTGCGAAAGCCGCTCATGCAGGCGGTCAAGGAGACCAAAGAGGTCGCTGCCGCCGTCGAGGCCAAGGAG
TTTGACAGGGCCATGTCGCTGCGTGATACCGAGTTCGCCGACCAGTACAGGTCCTACTTGACGACGACGAATGTC
TTTGCGGGCGATCGCAAACTACCAGAGAAGAGCAGGATGAAGATTGGCTTCATCAACGTGGGCGCTCCGGCCGGC
GGTATGAACGCCGCTGTGCGTGCCGCTGTTGCGTACTGCCTCAGCCGTGGCCACGATCCCATTGCCATTCACAAC
GGATTCGCTGGCTTCGCGCGCCATCACGACGACAAACCCCTTGGCGCCGTCCGCCCCTTCGACTGGCTCGAGGTT
GACGGCTGGGCCAGCAAAGGCGGCTCCGAGATCGGCACCAACCGCGAGCTGCCATCAGAGTCGGGCATGGAGCTC
ATTGCCAACCTGATCGAGCAGTATCAGTTCGATGCCCTCTTCATCGTCGGCGGCTTCGAGGCATTCCACTCGATC
TCTCAGCTGCGCAAGGCCAGGGACGAGTACCCGTCACTCTGCATTCCCATCTGCCTCCTTCCAGCTACCATCTCC
AACAACGTGCCTGGCACCGAGTACTCGCTCGGCTCCGACACCTGCCTCAATGAGCTCGTCCATTACTGCGACAAG
ATTAAGCAGTCCGCCTCGGCCACGCGTCGTCGAGTCTTCGTCATCGAGACACAGGGCGGCCGCTCTGGCTACGTC
GCCACCCTCAGTGGGCTCAACGTCGGTGCCTCGGCTGTCTACATTCCCGAGGAGGGTATCAGTCTCGAGATGCTC
AATGCCGACGTCAAGCACCTCAAGGAGGTCTTCCGCAAGGACACGGGCCAGTCTCGCGCCGGCCGCGTCATTCTC
GTCAACGAAAAGGCCAGCAAAGTCTACGACGCCAAGCTGATTGCAAAGATCATCCGAGAAGAGGCCCACGACCGG
TTCGAGAGCCGGGAGAGCATCCCCGGCCACGTGCAGCAGGGCGGCGTGCCGTCGCCCATGGATCGTTGCCGCGCC
GTTCGGCTGGCCATCAAGTGCATCCAGCACCTCGAAGACTTTGGGCGCAACGCTCACAATCGGGTCAAGAAGGAC
CCCAACAGCACGACCGTCATCGGAATTCAGGGGACCGAGGTCGTCTTCACACCCATGAAGAAGCTCGAGGAGGAG
TCGACCGACTGGCCCAACCGCCGGCCCAAGTTCGCCTACTGGCTGCATATGCGGGAAGTCGTCGACATCCTGGGC
GGGAGGCCTGACTATCCTCGGCCGGAGAAGAGCCTGGAGGGGCTTCTCGCCAAGGACACGAAGAGGGGGATCGCG
GTGGATTCTTGA
Transcript >Ophun1|5260
ATGACCTCCGGCGGGGACTCCCCGGGCATGAACGGCGTTGTCCGGGCCGTCGTCCGTATGGCCATACACATGGGA
TGTGATGCCTACGCTGTCTACGAGGGCTACGAAGGGCTCGTCCGCGGCGGCGACCTCATCAAGCAGATGGAGTGG
CACGATGTGCGTGGCTGGCTGTCTGAAGGCGGGACCCTCGTTGGTACTGCGCGCTGCATGGCCTTTTACGAGCGT
CCCGGTCGCCTGGCTGCGGCCAAGAACATGGTTCTCCAGGGCATCGACGCCCTCATCATCTGCGGTGGTGATGGT
TCGCTCACGGGTGCCGACCGCTTCCGCTCCGAATGGCCCTCTCTCCTGGCCGAGCTTGTCAAAAAGGGCGAGCTT
TCCAAGTTTCAGGTCAAGCCCTACGAGCACCTAAACATTGTAGGCATCGTTGGCTCCATCGACAACGACCTCTCC
GGAACCGATGCCACCATCGGCTGCTACTCGGCCCTCTCTCGAATCTGCGAAATGGTCGACTACATCGAGGCCACG
GCGTCGTCGCACTCGCGAGCCTTTGTCATCGAAGTCATGGGTCGTCACTGCGGCTGGCTAGCTCTTCTCGCCGGT
GTGGCTACAGGTGCCGACTTCGTCTTCATCCCCGAACGCCCGCAGGACTCGGACTGGCGCCATGAAATGTCTGAC
GTCGTTCGCAGGCATCGGACGCTAGGAAAGCGCAAGACCATCGTCATCGTCGCCGAGGGAGCCCGCGACAAGGAC
GGGGCCAAGATCCATCCCGAGGCCATCAAAGATCTGCTGTCTGACAAGGGTGAAGGATGCCTGGGCCTCGACACA
CGTATCACGACGCTCGGCCATGTGCAGCGCGGTGGCACCGCCGTCGCCTACGATCGTACGCTGGCCACACTGCAG
GGAGTCGAGGCCGTCAAAGCCGTACTCGAGGCAACGCCTGAAACGGAGACGTGCTTTATCGCCATTACCGAGAAT
AAGATTGTGCGAAAGCCGCTCATGCAGGCGGTCAAGGAGACCAAAGAGGTCGCTGCCGCCGTCGAGGCCAAGGAG
TTTGACAGGGCCATGTCGCTGCGTGATACCGAGTTCGCCGACCAGTACAGGTCCTACTTGACGACGACGAATGTC
TTTGCGGGCGATCGCAAACTACCAGAGAAGAGCAGGATGAAGATTGGCTTCATCAACGTGGGCGCTCCGGCCGGC
GGTATGAACGCCGCTGTGCGTGCCGCTGTTGCGTACTGCCTCAGCCGTGGCCACGATCCCATTGCCATTCACAAC
GGATTCGCTGGCTTCGCGCGCCATCACGACGACAAACCCCTTGGCGCCGTCCGCCCCTTCGACTGGCTCGAGGTT
GACGGCTGGGCCAGCAAAGGCGGCTCCGAGATCGGCACCAACCGCGAGCTGCCATCAGAGTCGGGCATGGAGCTC
ATTGCCAACCTGATCGAGCAGTATCAGTTCGATGCCCTCTTCATCGTCGGCGGCTTCGAGGCATTCCACTCGATC
TCTCAGCTGCGCAAGGCCAGGGACGAGTACCCGTCACTCTGCATTCCCATCTGCCTCCTTCCAGCTACCATCTCC
AACAACGTGCCTGGCACCGAGTACTCGCTCGGCTCCGACACCTGCCTCAATGAGCTCGTCCATTACTGCGACAAG
ATTAAGCAGTCCGCCTCGGCCACGCGTCGTCGAGTCTTCGTCATCGAGACACAGGGCGGCCGCTCTGGCTACGTC
GCCACCCTCAGTGGGCTCAACGTCGGTGCCTCGGCTGTCTACATTCCCGAGGAGGGTATCAGTCTCGAGATGCTC
AATGCCGACGTCAAGCACCTCAAGGAGGTCTTCCGCAAGGACACGGGCCAGTCTCGCGCCGGCCGCGTCATTCTC
GTCAACGAAAAGGCCAGCAAAGTCTACGACGCCAAGCTGATTGCAAAGATCATCCGAGAAGAGGCCCACGACCGG
TTCGAGAGCCGGGAGAGCATCCCCGGCCACGTGCAGCAGGGCGGCGTGCCGTCGCCCATGGATCGTTGCCGCGCC
GTTCGGCTGGCCATCAAGTGCATCCAGCACCTCGAAGACTTTGGGCGCAACGCTCACAATCGGGTCAAGAAGGAC
CCCAACAGCACGACCGTCATCGGAATTCAGGGGACCGAGGTCGTCTTCACACCCATGAAGAAGCTCGAGGAGGAG
TCGACCGACTGGCCCAACCGCCGGCCCAAGTTCGCCTACTGGCTGCATATGCGGGAAGTCGTCGACATCCTGGGC
GGGAGGCCTGACTATCCTCGGCCGGAGAAGAGCCTGGAGGGGCTTCTCGCCAAGGACACGAAGAGGGGGATCGCG
GTGGATTCTTGA
Gene >Ophun1|5260
ATGACCTCCGGCGGGGACTCCCCGGGCATGAACGGCGTTGTCCGGGCCGTCGTCCGTATGGCCATACACATGGGA
TGTGATGCCTACGCTGTCTACGAGGGCTACGAAGGGCTCGTCCGCGGCGGCGACCTCATCAAGCAGATGGAGTGG
CACGATGTGCGTGGCTGGCTGTCTGAAGGCGGGACCCTCGTTGGTACTGCGCGCTGCATGGCCTTTTACGAGCGT
CCCGGTCGCCTGGCTGCGGCCAAGAACATGGTTCTCCAGGGCATCGACGCCCTCATCATCTGCGGTGGTGATGGT
TCGCTCACGGGTGCCGACCGCTTCCGCTCCGAATGGCCCTCTCTCCTGGCCGAGCTTGTCAAAAAGGGCGAGCTT
TCCAAGTTTCAGGTCAAGCCCTACGAGCACCTAAACATTGTAGGCATCGTTGGCTCCATCGACAACGACCTCTCC
GGAACCGATGCCACCATCGGCTGCTACTCGGCCCTCTCTCGAATCTGCGAAATGGTCGACTACATCGAGGCCACG
GCGTCGTCGCACTCGCGAGCCTTTGTCATCGAAGTCATGGGTCGTCACTGCGGCTGGCTAGCTCTTCTCGCCGGT
GTGGCTACAGGTGCCGACTTCGTCTTCATCCCCGAACGCCCGCAGGACTCGGACTGGCGCCATGAAATGTCTGAC
GTCGTTCGCAGGGTAAGCTCTTGAATCTGCTTCACTATATGGGTCGCTCTTTGACGCACGCCTGCAGCATCGGAC
GCTAGGAAAGCGCAAGACCATCGTCATCGTCGCCGAGGGAGCCCGCGACAAGGACGGGGCCAAGATCCATCCCGA
GGCCATCAAAGATCTGCTGTCTGACAAGGGTGAAGGATGCCTGGGCCTCGACACACGTATCACGACGCTCGGCCA
TGTGCAGCGCGGTGGCACCGCCGTCGCCTACGATCGTACGCTGGCCACACTGCAGGGAGTCGAGGCCGTCAAAGC
CGTACTCGAGGCAACGCCTGAAACGGAGACGTGCTTTATCGCCATTACCGAGAATAAGATTGTGCGAAAGCCGCT
CATGCAGGCGGTCAAGGAGACCAAAGAGGTCGCTGCCGCCGTCGAGGCCAAGGAGTTTGACAGGGCCATGTCGCT
GCGTGATACCGAGTTCGCCGACCAGTACAGGTCCTACTTGACGACGACGAATGTCTTTGCGGGCGATCGCAAACT
ACCAGAGAAGAGCGTGAGTCACATCTGCGTCTACTGACAAGCGAGGGCTGACACAAGCCCATGAAGAGGATGAAG
ATTGGCTTCATCAACGTGGGCGCTCCGGCCGGCGGTATGAACGCCGCTGTGCGTGCCGCTGTTGCGTACTGCCTC
AGCCGTGGCCACGATCCCATTGCCATTCACAACGGATTCGCTGGCTTCGCGCGCCATCACGACGACAAACCCCTT
GGCGCCGTCCGCCCCTTCGACTGGCTCGAGGTTGACGGCTGGGCCAGCAAAGGCGGCTCCGAGATCGGCACCAAC
CGCGAGCTGCCATCAGAGTCGGGCATGGAGCTCATTGCCAACCTGATCGAGCAGTATCAGTTCGATGCCCTCTTC
ATCGTCGGCGGCTTCGAGGCATTCCACTCGATCTCTCAGCTGCGCAAGGCCAGGGACGAGTACCCGTCACTCTGC
ATTCCCATCTGCCTCCTTCCAGCTACCATCTCCAACAACGTGCCTGGCACCGAGTACTCGCTCGGCTCCGACACC
TGCCTCAATGAGCTCGTCCATTACTGCGACAAGATTAAGCAGTCCGCCTCGGCCACGCGTCGTCGAGTCTTCGTC
ATCGAGACACAGGGCGGCCGCTCTGGCTACGTCGCCACCCTCAGTGGGCTCAACGTCGGTGCCTCGGCTGTCTAC
ATTCCCGAGGAGGGTATCAGTCTCGAGATGCTCAATGCCGACGTCAAGCACCTCAAGGAGGTCTTCCGCAAGGAC
ACGGGCCAGTCTCGCGCCGGCCGCGTCATTCTCGTCAACGAAAAGGCCAGCAAAGTCTACGACGCCAAGCTGATT
GCAAAGATCATCCGAGAAGAGGCCCACGACCGGTTCGAGAGCCGGGAGAGCATCCCCGGCCACGTGCAGCAGGGC
GGCGTGCCGTCGCCCATGGATCGTTGCCGCGCCGTTCGGCTGGCCATCAAGTGCATCCAGCACCTCGAAGACTTT
GGGCGCAACGCTCACAATCGGGTCAAGAAGGACCCCAACAGCACGACCGTCATCGGAATTCAGGGGACCGAGGTC
GTCTTCACACCCATGAAGAAGCTCGAGGAGGAGTCGACCGACTGGCCCAACCGCCGGCCCAAGTTCGCCTACTGG
CTGCATATGCGGGAAGTCGTCGACATCCTGGGCGGGAGGCCTGACTATCCTCGGCCGGAGAAGAGCCTGGAGGGG
CTTCTCGCCAAGGACACGAAGAGGGGGATCGCGGTGGATTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail