Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5259
Gene name
LocationContig_51:9817..10967
Strand-
Gene length (bp)1150
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 6.0E-07 103 162

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 1.00002

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1318
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4854
Ophiocordyceps australis map64 (Brazil) OphauB2|5299
Ophiocordyceps camponoti-floridani Ophcf2|00783
Ophiocordyceps camponoti-rufipedis Ophun1|5259 (this protein)
Ophiocordyceps kimflemingae Ophio5|2609
Ophiocordyceps subramaniannii Hirsu2|10676

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5259
MRLNLAATFLALASLSVACSHHVRREALSAGPSLGLSARFVPLLKRQTQSKQSVNMFLIRVQNTSAPLFACYLGG
EAGREPKDALQSTTVDLGNEEPDPNNDLGVTSYFLSDGGEAVMFDTLTSPVLASACLDMVQSNQEAGIGQVQQVV
LSHKHQDHIAGVSAPELEQAKIITQDNTRQALAAVRSRAPDETYTESKNLTVGQSNVTLLHFVGHTNDGTGACMG
DVCLMGDECEDSVPFIAEPERIQSQIANLNSTIQTVQSRGIVKVCPAHGSGNTIAGGCFSLSLCQSNMRYLQLMA
SDLQTACGMSLQQLAPQFGRQSEEVTQAYAGVHKENCQSLSQAQSGRRGDEEVEASIFGVG*
Coding >Ophun1|5259
ATGCGGTTGAACTTGGCGGCCACTTTCTTGGCCCTCGCCAGCTTATCCGTCGCGTGCTCACATCATGTGCGACGA
GAGGCTCTCAGTGCAGGCCCGAGTCTGGGTCTTTCCGCTCGCTTTGTGCCACTGCTGAAGCGGCAGACGCAGAGC
AAGCAAAGCGTCAACATGTTCTTGATCCGGGTTCAGAACACGTCGGCGCCGCTGTTCGCCTGCTACCTCGGCGGC
GAGGCGGGTAGAGAGCCGAAGGATGCGCTGCAGAGCACGACGGTCGACCTGGGGAACGAAGAGCCGGACCCGAAC
AACGACCTGGGCGTCACCAGCTACTTTCTCTCCGACGGGGGCGAGGCCGTCATGTTCGACACGCTGACGTCGCCC
GTCCTCGCCTCGGCCTGTCTCGACATGGTGCAGAGCAACCAGGAGGCCGGCATCGGACAGGTTCAGCAGGTGGTG
CTCAGCCACAAGCACCAGGACCACATCGCGGGCGTGTCGGCGCCTGAGCTGGAGCAAGCCAAGATCATCACGCAA
GACAACACCAGGCAGGCCCTGGCGGCAGTCCGGTCACGGGCCCCGGACGAGACGTACACGGAGTCCAAGAACCTG
ACGGTCGGCCAGAGCAACGTGACTCTGCTTCACTTCGTCGGCCACACGAACGATGGCACGGGCGCGTGTATGGGC
GACGTCTGCCTGATGGGAGACGAGTGCGAAGACAGCGTGCCGTTCATCGCGGAGCCGGAGCGGATCCAGTCGCAG
ATTGCGAATCTCAACAGCACGATCCAGACGGTGCAGAGCCGGGGAATCGTCAAGGTGTGTCCGGCGCACGGAAGC
GGTAACACCATCGCGGGAGGATGCTTCTCGCTGTCGCTGTGCCAGTCCAACATGCGCTACCTGCAGCTCATGGCC
AGCGATCTTCAGACGGCCTGCGGCATGTCGCTGCAGCAGCTCGCACCGCAGTTTGGGAGGCAGTCGGAGGAGGTG
ACGCAGGCGTATGCGGGGGTGCACAAGGAGAATTGCCAGTCGCTGAGCCAGGCCCAGAGCGGGAGACGGGGAGAT
GAGGAGGTTGAAGCCTCGATATTTGGTGTAGGTTAG
Transcript >Ophun1|5259
ATGCGGTTGAACTTGGCGGCCACTTTCTTGGCCCTCGCCAGCTTATCCGTCGCGTGCTCACATCATGTGCGACGA
GAGGCTCTCAGTGCAGGCCCGAGTCTGGGTCTTTCCGCTCGCTTTGTGCCACTGCTGAAGCGGCAGACGCAGAGC
AAGCAAAGCGTCAACATGTTCTTGATCCGGGTTCAGAACACGTCGGCGCCGCTGTTCGCCTGCTACCTCGGCGGC
GAGGCGGGTAGAGAGCCGAAGGATGCGCTGCAGAGCACGACGGTCGACCTGGGGAACGAAGAGCCGGACCCGAAC
AACGACCTGGGCGTCACCAGCTACTTTCTCTCCGACGGGGGCGAGGCCGTCATGTTCGACACGCTGACGTCGCCC
GTCCTCGCCTCGGCCTGTCTCGACATGGTGCAGAGCAACCAGGAGGCCGGCATCGGACAGGTTCAGCAGGTGGTG
CTCAGCCACAAGCACCAGGACCACATCGCGGGCGTGTCGGCGCCTGAGCTGGAGCAAGCCAAGATCATCACGCAA
GACAACACCAGGCAGGCCCTGGCGGCAGTCCGGTCACGGGCCCCGGACGAGACGTACACGGAGTCCAAGAACCTG
ACGGTCGGCCAGAGCAACGTGACTCTGCTTCACTTCGTCGGCCACACGAACGATGGCACGGGCGCGTGTATGGGC
GACGTCTGCCTGATGGGAGACGAGTGCGAAGACAGCGTGCCGTTCATCGCGGAGCCGGAGCGGATCCAGTCGCAG
ATTGCGAATCTCAACAGCACGATCCAGACGGTGCAGAGCCGGGGAATCGTCAAGGTGTGTCCGGCGCACGGAAGC
GGTAACACCATCGCGGGAGGATGCTTCTCGCTGTCGCTGTGCCAGTCCAACATGCGCTACCTGCAGCTCATGGCC
AGCGATCTTCAGACGGCCTGCGGCATGTCGCTGCAGCAGCTCGCACCGCAGTTTGGGAGGCAGTCGGAGGAGGTG
ACGCAGGCGTATGCGGGGGTGCACAAGGAGAATTGCCAGTCGCTGAGCCAGGCCCAGAGCGGGAGACGGGGAGAT
GAGGAGGTTGAAGCCTCGATATTTGGTGTAGGTTAG
Gene >Ophun1|5259
ATGCGGTTGAACTTGGCGGCCACTTTCTTGGCCCTCGCCAGCTTATCCGTCGCGTGCTCACATCATGTGCGACGA
GAGGCTCTCAGTGCAGGCCCGAGTCTGGGTCTTTCCGCTCGCTTTGTGCCGTGAGTGCGGATCCGATCGACAAGC
TCTTGTTGAAGAGAATTCGACAGCTAACCATGTGGAAAGACTGCTGAAGCGGCAGACGCAGAGCAAGCAAAGCGT
CAACATGTTCTTGATCCGGGTTCAGAACACGTCGGCGCCGCTGTTCGCCTGCTACCTCGGCGGCGAGGCGGGTAG
AGAGCCGAAGGATGCGCTGCAGAGCACGACGGTCGACCTGGGGAACGAAGAGCCGGACCCGAACAACGACCTGGG
CGTCACCAGCTACTTTCTCTCCGACGGGGGCGAGGCCGTCATGTTCGACACGCTGACGTCGCCCGTCCTCGCCTC
GGCCTGTCTCGACATGGTGCAGAGCAACCAGGAGGCCGGCATCGGACAGGTTCAGCAGGTGGTGCTCAGCCACAA
GCACCAGGACCACATCGCGGGCGTGTCGGCGCCTGAGCTGGAGCAAGCCAAGATCATCACGCAAGACAACACCAG
GCAGGCCCTGGCGGCAGTCCGGTCACGGGCCCCGGACGAGACGTACACGGAGTCCAAGAACCTGACGGTCGGCCA
GAGCAACGTGACTCTGCTTCACTTCGTCGGCCACACGAACGATGGCACGGGCGCGTGTATGGGCGACGTCTGCCT
GATGGGAGACGAGTGCGAAGACAGCGTGCCGTTCATCGCGGAGCCGGAGCGGATCCAGTCGCAGATTGCGAATCT
CAACAGCACGATCCAGACGGTGCAGAGCCGGGGAATCGTCAAGGTGTGTCCGGCGCACGGAAGCGGTAACACCAT
CGCGGGAGGATGCTTCTCGCTGTCGCTGTGCCAGTCCAACATGCGCTACCTGCAGCTCATGGCCAGCGATCTTCA
GACGGCCTGCGGCATGTCGCTGCAGCAGCTCGCACCGCAGTTTGGGAGGCAGTCGGAGGAGGTGACGCAGGCGTA
TGCGGGGGTGCACAAGGAGAATTGCCAGTCGCTGAGCCAGGCCCAGAGCGGGAGACGGGGAGATGAGGAGGTTGA
AGCCTCGATATTTGGTGTAGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail