Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5258
Gene name
LocationContig_51:7442..9174
Strand-
Gene length (bp)1732
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241
Ophiocordyceps australis map64 (Brazil) OphauB2|5099
Ophiocordyceps camponoti-floridani Ophcf2|00782
Ophiocordyceps camponoti-rufipedis Ophun1|5258 (this protein)
Ophiocordyceps kimflemingae Ophio5|2610
Ophiocordyceps subramaniannii Hirsu2|3776

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5258
MAHRSSRMTDFEERDYYAAPRRPAADLDDRDYRPRAGPRSRVALSEYDEVDVRLRDRELDRTPGFLRDDGRRPEA
GPMVLRQRDIETIDRHARSPSPPPVRRREMVRRPKSTSPPTMRGSEHENIHTRIVERERDRVRSPSVVRCRSPSP
LPVRFVERRRRSPSPVSQHDHIRIVERERQRVPSPSPSPSPPPAPAIIRGPTIEREVITHWTDVDHGVVRAKPPS
PRARSRPRERETDIDISLSKDRTEVDIHQSNNRPRSKSRERRSRYHEDDLVRRDGNRLRVDEYLSPRRRAQSAAP
LCSPAEEEGEYLTSKMDSRGRMGEAWGGVTKDWCIVDVPPGTERVRMDGAGGASTDTTWSRYSGVRRTQFNPERD
GVLVPRDPSPAPSRDRASVYDREREIDVDIDRRVSRTPLPPPQPPAPPKELWTEITKDLVVREAIEQQGYEYEET
KWFFYIMDYLRYEDVLHLTQLSKSIRRARKERAREIEWERDWRDEWERPFRRPMHDHHDHYRSREEWDDERVRER
EFVYDSRRPDRGYLR*
Coding >Ophun1|5258
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCTCCTCGACGTCCGGCTGCT
GACCTCGACGACCGGGACTATCGTCCTCGTGCCGGCCCGAGGTCCCGTGTGGCGTTGAGTGAGTACGACGAGGTC
GACGTCCGGCTGCGTGACCGCGAGCTGGATCGTACCCCGGGCTTCTTAAGAGATGACGGTCGTCGACCAGAGGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATTGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTTCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAGAATATT
CACACCAGGATTGTCGAGAGGGAGCGCGATAGGGTGAGGAGCCCGTCTGTCGTCCGCTGTCGCTCTCCGTCTCCG
CTCCCTGTAAGATTCGTCGAGCGTCGTCGTCGGTCTCCATCGCCGGTAAGCCAGCACGATCACATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCGGCTCCGGCCATCATTCGCGGC
CCGACAATTGAGCGTGAGGTCATCACCCACTGGACCGACGTCGACCATGGCGTCGTTCGGGCCAAACCCCCGAGC
CCTAGGGCCCGTTCGCGCCCCAGGGAGCGGGAGACGGATATTGACATTTCCCTCTCCAAGGACCGGACAGAGGTC
GATATTCATCAGTCCAACAACCGTCCACGCTCCAAGAGCCGCGAGCGTCGGTCACGCTACCACGAGGACGACCTC
GTCCGTCGCGATGGCAACCGACTCCGGGTGGACGAGTATTTGAGTCCGCGCCGACGAGCCCAGTCGGCCGCTCCG
CTCTGCTCACCAGCCGAAGAAGAGGGCGAATACCTCACGTCCAAGATGGACTCTCGGGGCCGCATGGGCGAGGCC
TGGGGCGGTGTAACCAAGGATTGGTGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTACGTATGGACGGCGCC
GGGGGCGCCAGCACCGACACGACCTGGTCAAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACCCCGAGAGAGAC
GGGGTTCTCGTGCCCAGAGATCCGTCGCCCGCCCCTTCGCGGGATCGCGCCAGCGTCTACGACCGGGAGAGGGAG
ATTGACGTCGATATCGATCGAAGGGTGAGTCGCACGCCCTTGCCGCCTCCGCAGCCTCCGGCGCCGCCCAAGGAG
CTATGGACCGAGATTACCAAGGATCTCGTTGTTCGGGAAGCCATCGAGCAGCAGGGCTACGAGTACGAGGAGACC
AAGTGGTTCTTTTACATCATGGATTACCTTCGTTATGAAGATGTCCTTCACCTGACACAGCTGTCGAAAAGCATC
CGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGGGAGCGCGACTGGCGGGACGAATGGGAGCGGCCATTC
CGACGCCCCATGCACGACCACCATGATCACTACCGTTCGCGGGAGGAATGGGACGACGAGCGGGTGAGAGAGCGC
GAGTTCGTCTACGACAGCCGTCGACCGGACCGCGGATACCTCCGATGA
Transcript >Ophun1|5258
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCTCCTCGACGTCCGGCTGCT
GACCTCGACGACCGGGACTATCGTCCTCGTGCCGGCCCGAGGTCCCGTGTGGCGTTGAGTGAGTACGACGAGGTC
GACGTCCGGCTGCGTGACCGCGAGCTGGATCGTACCCCGGGCTTCTTAAGAGATGACGGTCGTCGACCAGAGGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATTGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTTCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAGAATATT
CACACCAGGATTGTCGAGAGGGAGCGCGATAGGGTGAGGAGCCCGTCTGTCGTCCGCTGTCGCTCTCCGTCTCCG
CTCCCTGTAAGATTCGTCGAGCGTCGTCGTCGGTCTCCATCGCCGGTAAGCCAGCACGATCACATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCGGCTCCGGCCATCATTCGCGGC
CCGACAATTGAGCGTGAGGTCATCACCCACTGGACCGACGTCGACCATGGCGTCGTTCGGGCCAAACCCCCGAGC
CCTAGGGCCCGTTCGCGCCCCAGGGAGCGGGAGACGGATATTGACATTTCCCTCTCCAAGGACCGGACAGAGGTC
GATATTCATCAGTCCAACAACCGTCCACGCTCCAAGAGCCGCGAGCGTCGGTCACGCTACCACGAGGACGACCTC
GTCCGTCGCGATGGCAACCGACTCCGGGTGGACGAGTATTTGAGTCCGCGCCGACGAGCCCAGTCGGCCGCTCCG
CTCTGCTCACCAGCCGAAGAAGAGGGCGAATACCTCACGTCCAAGATGGACTCTCGGGGCCGCATGGGCGAGGCC
TGGGGCGGTGTAACCAAGGATTGGTGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTACGTATGGACGGCGCC
GGGGGCGCCAGCACCGACACGACCTGGTCAAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACCCCGAGAGAGAC
GGGGTTCTCGTGCCCAGAGATCCGTCGCCCGCCCCTTCGCGGGATCGCGCCAGCGTCTACGACCGGGAGAGGGAG
ATTGACGTCGATATCGATCGAAGGGTGAGTCGCACGCCCTTGCCGCCTCCGCAGCCTCCGGCGCCGCCCAAGGAG
CTATGGACCGAGATTACCAAGGATCTCGTTGTTCGGGAAGCCATCGAGCAGCAGGGCTACGAGTACGAGGAGACC
AAGTGGTTCTTTTACATCATGGATTACCTTCGTTATGAAGATGTCCTTCACCTGACACAGCTGTCGAAAAGCATC
CGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGGGAGCGCGACTGGCGGGACGAATGGGAGCGGCCATTC
CGACGCCCCATGCACGACCACCATGATCACTACCGTTCGCGGGAGGAATGGGACGACGAGCGGGTGAGAGAGCGC
GAGTTCGTCTACGACAGCCGTCGACCGGACCGCGGATACCTCCGATGA
Gene >Ophun1|5258
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCTCCTCGACGTCCGGCTGCT
GACCTCGACGACCGGGACTATCGTCCTCGTGCCGGCCCGAGGTCCCGTGTGGCGTTGAGTGAGTACGACGAGGTC
GACGTCCGGCTGCGTGACCGCGAGCTGGATCGTACCCCGGGCTTCTTAAGAGATGACGGTCGTCGACCAGAGGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATTGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTTCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAGAATATT
CACACCAGGATTGTCGAGAGGGAGCGCGATAGGGTGAGGAGCCCGTCTGTCGTCCGCTGTCGCTCTCCGTCTCCG
CTCCCTGTAAGATTCGTCGAGCGTCGTCGTCGGTCTCCATCGCCGGTAAGCCAGCACGATCACATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCGGCTCCGGCCATCATTCGCGGC
CCGACAATTGAGCGTGAGGTCATCACCCACTGGACCGACGTCGACCATGGTAAGTCTTGGTGGACTCGACTTCTG
GACATGGCTGATTACAACTCTGCAGGCGTCGTTCGGGCCAAACCCCCGAGCCCTAGGGCCCGTTCGCGCCCCAGG
GAGCGGGAGACGGATATTGACATTTCCCTCTCCAAGGACCGGACAGAGGTCGATATTCATCAGTCCAACAACCGT
CCACGCTCCAAGAGCCGCGAGCGTCGGTCACGCTACCACGAGGACGACCTCGTCCGTCGCGATGGCAACCGACTC
CGGGTGGACGAGTATTTGAGTCCGCGCCGACGAGCCCAGTCGGCCGCTCCGCTCTGCTCACCAGCCGAAGAAGAG
GGCGAATACCTCACGTCCAAGATGGACTCTCGGGGCCGCATGGGCGAGGCCTGGGGCGGTGTAACCAAGGATTGG
TGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTACGTATGGACGGCGCCGGGGGCGCCAGCACCGACACGACC
TGGTCAAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACCCCGAGAGAGACGGGGTTCTCGTGCCCAGAGATCCG
TCGCCCGCCCCTTCGCGGGATCGCGCCAGCGTCTACGACCGGGAGAGGGAGATTGACGTCGATATCGATCGAAGG
GTGAGTCGCACGCCCTTGCCGCCTCCGCAGCCTCCGGCGCCGCCCAAGGAGCTATGGACCGAGATTACCAAGGAT
CTCGTTGTTCGGGAAGCCATCGAGCAGCAGGGCTACGAGTACGAGGAGACCAAGTGGTTCTTTTACATCATGGAT
TACCTTCGTTATGTAAGTTTATTGCCTGAACGCATGCTTGAAGCCGGGCACGCCACTGACGGCTGAACAGGAAGA
TGTCCTTCACCTGACACAGCTGTCGAAAAGCATCCGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGGGA
GCGCGACTGGCGGGACGAATGGGAGCGGCCATTCCGACGCCCCATGCACGACCACCATGATCACTACCGTTCGCG
GGAGGAATGGGACGACGAGCGGGTGAGAGAGCGCGAGTTCGTCTACGACAGCCGTCGACCGGACCGCGGATACCT
CCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail