Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5252
Gene name
LocationContig_508:12588..12951
Strand+
Gene length (bp)363
Transcript length (bp)264
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03311 Cornichon Cornichon protein 5.6E-31 6 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53173|ERV14_YEAST ER-derived vesicles protein ERV14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV14 PE=1 SV=3 6 87 2.0E-30
sp|P38312|ERV15_YEAST ER-derived vesicles protein ERV15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV15 PE=1 SV=1 2 87 6.0E-24
sp|O14038|YEY5_SCHPO Uncharacterized protein C2C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.05 PE=3 SV=1 5 86 9.0E-22
sp|Q9CX13|CNIH4_MOUSE Protein cornichon homolog 4 OS=Mus musculus GN=Cnih4 PE=2 SV=1 5 87 9.0E-17
sp|Q3T126|CNIH4_BOVIN Protein cornichon homolog 4 OS=Bos taurus GN=CNIH4 PE=2 SV=1 5 87 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53173|ERV14_YEAST ER-derived vesicles protein ERV14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV14 PE=1 SV=3 6 87 2.0E-30
sp|P38312|ERV15_YEAST ER-derived vesicles protein ERV15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV15 PE=1 SV=1 2 87 6.0E-24
sp|O14038|YEY5_SCHPO Uncharacterized protein C2C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.05 PE=3 SV=1 5 86 9.0E-22
sp|Q9CX13|CNIH4_MOUSE Protein cornichon homolog 4 OS=Mus musculus GN=Cnih4 PE=2 SV=1 5 87 9.0E-17
sp|Q3T126|CNIH4_BOVIN Protein cornichon homolog 4 OS=Bos taurus GN=CNIH4 PE=2 SV=1 5 87 2.0E-16
sp|Q6P3N5|CNIH4_XENTR Protein cornichon homolog 4 OS=Xenopus tropicalis GN=cnih4 PE=2 SV=1 5 87 7.0E-16
sp|Q5R9M4|CNIH4_PONAB Protein cornichon homolog 4 OS=Pongo abelii GN=CNIH4 PE=2 SV=1 5 87 1.0E-15
sp|Q9P003|CNIH4_HUMAN Protein cornichon homolog 4 OS=Homo sapiens GN=CNIH4 PE=1 SV=1 5 87 1.0E-15
sp|Q9P6K6|ERV14_SCHPO ER-derived vesicles protein erv14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv14 PE=3 SV=2 1 59 6.0E-15
sp|P49858|CNI_DROME Protein cornichon OS=Drosophila melanogaster GN=cni PE=1 SV=1 6 86 2.0E-13
sp|Q5RDB5|CNIH1_PONAB Protein cornichon homolog 1 OS=Pongo abelii GN=CNIH1 PE=2 SV=1 6 84 3.0E-11
sp|O35372|CNIH1_MOUSE Protein cornichon homolog 1 OS=Mus musculus GN=Cnih1 PE=2 SV=2 6 84 3.0E-11
sp|O95406|CNIH1_HUMAN Protein cornichon homolog 1 OS=Homo sapiens GN=CNIH1 PE=1 SV=1 6 84 3.0E-11
sp|Q5BIN6|CNIH1_BOVIN Protein cornichon homolog 1 OS=Bos taurus GN=CNIH1 PE=2 SV=1 6 84 3.0E-11
sp|Q8GWT5|CNIH3_ARATH Protein cornichon homolog 3 OS=Arabidopsis thaliana GN=At1g62880 PE=2 SV=1 4 84 4.0E-10
sp|P52159|CNI_DROVI Protein cornichon OS=Drosophila virilis GN=cni PE=3 SV=2 6 84 1.0E-09
sp|Q22361|CNI1_CAEEL Protein cornichon homolog 1 OS=Caenorhabditis elegans GN=cni-1 PE=1 SV=2 6 84 1.0E-09
sp|Q5BL21|CNIH2_DANRE Protein cornichon homolog 2 OS=Danio rerio GN=cnih2 PE=2 SV=1 6 84 6.0E-09
sp|Q84W04|CNIH4_ARATH Protein cornichon homolog 4 OS=Arabidopsis thaliana GN=At1g12390 PE=1 SV=1 4 84 6.0E-09
sp|Q3EDD7|CNIH2_ARATH Probable protein cornichon homolog 2 OS=Arabidopsis thaliana GN=At1g12340 PE=2 SV=2 24 84 1.0E-08
sp|Q6ZWS4|CNIH3_MOUSE Protein cornichon homolog 3 OS=Mus musculus GN=Cnih3 PE=2 SV=1 6 84 7.0E-08
sp|Q8TBE1|CNIH3_HUMAN Protein cornichon homolog 3 OS=Homo sapiens GN=CNIH3 PE=2 SV=1 6 84 7.0E-08
sp|D0Q0Y7|CNIH3_RAT Protein cornichon homolog 3 OS=Rattus norvegicus GN=Cnih3 PE=1 SV=1 6 84 8.0E-08
sp|Q9C7D7|CNIH1_ARATH Protein cornichon homolog 1 OS=Arabidopsis thaliana GN=At3g12180 PE=2 SV=1 19 85 8.0E-08
sp|Q9SZ74|CNIH5_ARATH Protein cornichon homolog 5 OS=Arabidopsis thaliana GN=At4g12090 PE=2 SV=2 31 86 1.0E-07
sp|Q68EY2|CNIH2_XENLA Protein cornichon homolog 2 OS=Xenopus laevis GN=cnih2 PE=2 SV=1 6 84 3.0E-07
sp|Q0VFK3|CNIH2_XENTR Protein cornichon homolog 2 OS=Xenopus tropicalis GN=cnih2 PE=2 SV=1 6 84 4.0E-07
sp|Q5BJU5|CNIH2_RAT Protein cornichon homolog 2 OS=Rattus norvegicus GN=Cnih2 PE=1 SV=1 6 84 4.0E-07
sp|O35089|CNIH2_MOUSE Protein cornichon homolog 2 OS=Mus musculus GN=Cnih2 PE=1 SV=2 6 84 4.0E-07
sp|Q6PI25|CNIH2_HUMAN Protein cornichon homolog 2 OS=Homo sapiens GN=CNIH2 PE=1 SV=1 6 84 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 61 83 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5252
MMSGEAWLYLLAVLINAVNLFLQVFFTIMYSDLECDYINPIELCNRLNAYVVPEAAVHALLTFLFLVNGYWLALL
LNMPLLLWNAKK*
Coding >Ophun1|5252
ATGATGTCCGGAGAGGCGTGGCTTTACCTTCTCGCCGTTTTAATCAACGCTGTGAATCTTTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTCGAATGCGACTACATCAATCCTATTGAACTCTGCAATCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCTGTACACGCGCTCCTAACGTTCCTTTTCCTCGTTAATGGATACTGGCTGGCCCTCCTT
TTGAACATGCCTCTCCTTCTCTGGAATGCGAAGAAGTAA
Transcript >Ophun1|5252
ATGATGTCCGGAGAGGCGTGGCTTTACCTTCTCGCCGTTTTAATCAACGCTGTGAATCTTTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTCGAATGCGACTACATCAATCCTATTGAACTCTGCAATCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCTGTACACGCGCTCCTAACGTTCCTTTTCCTCGTTAATGGATACTGGCTGGCCCTCCTT
TTGAACATGCCTCTCCTTCTCTGGAATGCGAAGAAGTAA
Gene >Ophun1|5252
ATGATGTCCGGAGAGGCGTGGCTTTACCTTCTCGCCGTTTTAATCAACGCTGTGAATCTTTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTCGAATGGTAAGTCAAACCAGGCCTTGACTCCGCGATCCCCCTCGTCTCATCC
GAGCTGCCACCCTTTTACGAAGACCATTCGATCAGGCTAACGAATATTCGCAGCGACTACATCAATCCTATTGAA
CTCTGCAATCGGTTAAATGCTTACGTCGTGCCCGAAGCAGCTGTACACGCGCTCCTAACGTTCCTTTTCCTCGTT
AATGGATACTGGCTGGCCCTCCTTTTGAACATGCCTCTCCTTCTCTGGAATGCGAAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail