Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5246
Gene name
LocationContig_507:8971..10765
Strand+
Gene length (bp)1794
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 56 78 22
3 91 113 22
4 153 175 22
5 204 226 22
6 246 268 22
7 272 294 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup64
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1175
Ophiocordyceps australis 1348a (Ghana) OphauG2|3409
Ophiocordyceps australis map64 (Brazil) OphauB2|618
Ophiocordyceps australis map64 (Brazil) OphauB2|7597
Ophiocordyceps camponoti-floridani Ophcf2|01391
Ophiocordyceps camponoti-floridani Ophcf2|06327
Ophiocordyceps camponoti-rufipedis Ophun1|1065
Ophiocordyceps camponoti-rufipedis Ophun1|5246 (this protein)
Ophiocordyceps kimflemingae Ophio5|3089
Ophiocordyceps kimflemingae Ophio5|5724
Ophiocordyceps kimflemingae Ophio5|5779
Ophiocordyceps kimflemingae Ophio5|8003
Ophiocordyceps subramaniannii Hirsu2|10027
Ophiocordyceps subramaniannii Hirsu2|5650
Ophiocordyceps subramaniannii Hirsu2|5963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5246
MGSEFGVTPDTKPELRLDAVGVFWIVWAVVWTIVVLAGMSFLYVRREIPLLRIRGLPLSLAAVALMHFYWFAVQL
GYIYGPLMPEVAEYFIMSVWFPFGIALFHASNSRFLYVARAQKKYVMNAIDSGWDPERPRIRRTMLARWRMLDYS
YKMLLLVALGMGFQLFLTLFMFIVSRKFHSSFGIPGTEVEGTYMERKTEQGRGWEWWPSVFWQIFWAWIVAPVIL
WRARHLRDTQGWRTQTIACCIASLHASPMWLIALYVPGMAPVNNYFIPPQWIAISIMCIEIFTIFIPCWEVRKQQ
ALCQETLDSIARWESRQKSATHCGKSLSSSTPSWMRKAESISSSGNGSILTMDALEHTLAKNPEPLQHFSALRDF
SGENIAFLTRVREWRATYLVPASRPTTIVDEKKLETDSNVSTLSRECFESALLIYMDFISSNSAEFQVNLSSQDF
KNLQAVFEPAARIIYGDNASPDPATPFEEAPRALTSDSHDRIRYRGDIPDLFTDTVFDDSEMSIKYLVLTNTWPK
FIKERRSFDAASSVESARN*
Coding >Ophun1|5246
ATGGGTTCCGAGTTCGGCGTCACGCCCGACACCAAGCCCGAGCTGCGGCTCGATGCCGTCGGCGTCTTCTGGATC
GTCTGGGCCGTCGTCTGGACCATCGTTGTCCTGGCTGGCATGAGCTTTCTCTATGTCCGGCGAGAGATTCCGCTT
CTTCGCATTAGGGGGTTGCCGTTGTCGTTGGCTGCTGTCGCCTTGATGCACTTTTACTGGTTTGCCGTTCAGCTG
GGTTATATCTACGGGCCGTTGATGCCGGAGGTTGCCGAGTACTTCATCATGAGTGTTTGGTTTCCCTTTGGCATT
GCCCTGTTTCATGCTTCCAACAGTCGTTTCCTCTACGTTGCCCGGGCGCAGAAGAAGTACGTTATGAACGCCATC
GACTCGGGCTGGGATCCGGAACGACCGCGGATTCGCAGGACGATGCTGGCTCGTTGGCGGATGCTGGATTATAGC
TACAAGATGCTGCTGCTCGTCGCGTTGGGCATGGGGTTTCAGCTCTTCCTCACGCTCTTCATGTTCATCGTCTCA
CGCAAGTTTCACTCATCTTTTGGCATCCCCGGAACCGAAGTCGAGGGCACCTACATGGAGAGAAAGACGGAGCAG
GGCCGCGGTTGGGAGTGGTGGCCGTCCGTATTCTGGCAGATCTTCTGGGCCTGGATCGTGGCTCCTGTTATCCTG
TGGCGAGCTCGTCACCTCCGCGATACTCAGGGCTGGCGAACACAGACGATAGCCTGCTGTATAGCAAGCCTCCAC
GCTTCTCCCATGTGGCTCATCGCCCTCTACGTCCCCGGCATGGCCCCCGTCAACAACTACTTCATTCCCCCTCAA
TGGATCGCCATCTCCATCATGTGCATCGAAATCTTCACCATCTTCATCCCCTGCTGGGAAGTCCGCAAGCAGCAG
GCCCTCTGCCAGGAGACGCTCGACTCCATCGCCCGCTGGGAATCGCGGCAAAAGTCCGCCACTCACTGCGGCAAG
TCGCTGTCTTCCAGCACGCCCTCGTGGATGCGAAAGGCCGAGTCCATCAGCAGCTCTGGGAACGGTAGCATCCTC
ACCATGGACGCGCTGGAGCACACGCTGGCCAAGAACCCTGAACCTCTGCAGCACTTCTCGGCGCTGAGGGACTTT
TCTGGTGAGAATATCGCCTTCTTGACCAGGGTTCGTGAGTGGAGGGCGACGTATCTGGTTCCTGCGAGCCGGCCT
ACCACCATAGTCGATGAGAAGAAGCTGGAGACGGACTCGAACGTGTCTACCCTATCGAGGGAGTGTTTCGAGAGC
GCGCTGCTCATCTACATGGACTTTATCAGCAGTAACAGCGCCGAGTTCCAGGTCAACCTCTCGTCTCAAGACTTT
AAGAACCTGCAGGCCGTCTTCGAGCCGGCTGCACGCATCATATACGGCGACAACGCGAGCCCAGATCCAGCAACT
CCCTTCGAAGAGGCGCCTCGAGCGCTGACGAGCGATTCTCACGACCGGATACGATACCGCGGCGATATCCCCGAT
CTCTTCACCGATACCGTCTTTGACGACTCCGAGATGAGCATCAAGTATCTCGTCTTGACCAACACGTGGCCCAAG
TTTATCAAGGAGAGGAGGTCGTTTGATGCGGCCAGCAGCGTTGAGTCTGCCCGGAACTGA
Transcript >Ophun1|5246
ATGGGTTCCGAGTTCGGCGTCACGCCCGACACCAAGCCCGAGCTGCGGCTCGATGCCGTCGGCGTCTTCTGGATC
GTCTGGGCCGTCGTCTGGACCATCGTTGTCCTGGCTGGCATGAGCTTTCTCTATGTCCGGCGAGAGATTCCGCTT
CTTCGCATTAGGGGGTTGCCGTTGTCGTTGGCTGCTGTCGCCTTGATGCACTTTTACTGGTTTGCCGTTCAGCTG
GGTTATATCTACGGGCCGTTGATGCCGGAGGTTGCCGAGTACTTCATCATGAGTGTTTGGTTTCCCTTTGGCATT
GCCCTGTTTCATGCTTCCAACAGTCGTTTCCTCTACGTTGCCCGGGCGCAGAAGAAGTACGTTATGAACGCCATC
GACTCGGGCTGGGATCCGGAACGACCGCGGATTCGCAGGACGATGCTGGCTCGTTGGCGGATGCTGGATTATAGC
TACAAGATGCTGCTGCTCGTCGCGTTGGGCATGGGGTTTCAGCTCTTCCTCACGCTCTTCATGTTCATCGTCTCA
CGCAAGTTTCACTCATCTTTTGGCATCCCCGGAACCGAAGTCGAGGGCACCTACATGGAGAGAAAGACGGAGCAG
GGCCGCGGTTGGGAGTGGTGGCCGTCCGTATTCTGGCAGATCTTCTGGGCCTGGATCGTGGCTCCTGTTATCCTG
TGGCGAGCTCGTCACCTCCGCGATACTCAGGGCTGGCGAACACAGACGATAGCCTGCTGTATAGCAAGCCTCCAC
GCTTCTCCCATGTGGCTCATCGCCCTCTACGTCCCCGGCATGGCCCCCGTCAACAACTACTTCATTCCCCCTCAA
TGGATCGCCATCTCCATCATGTGCATCGAAATCTTCACCATCTTCATCCCCTGCTGGGAAGTCCGCAAGCAGCAG
GCCCTCTGCCAGGAGACGCTCGACTCCATCGCCCGCTGGGAATCGCGGCAAAAGTCCGCCACTCACTGCGGCAAG
TCGCTGTCTTCCAGCACGCCCTCGTGGATGCGAAAGGCCGAGTCCATCAGCAGCTCTGGGAACGGTAGCATCCTC
ACCATGGACGCGCTGGAGCACACGCTGGCCAAGAACCCTGAACCTCTGCAGCACTTCTCGGCGCTGAGGGACTTT
TCTGGTGAGAATATCGCCTTCTTGACCAGGGTTCGTGAGTGGAGGGCGACGTATCTGGTTCCTGCGAGCCGGCCT
ACCACCATAGTCGATGAGAAGAAGCTGGAGACGGACTCGAACGTGTCTACCCTATCGAGGGAGTGTTTCGAGAGC
GCGCTGCTCATCTACATGGACTTTATCAGCAGTAACAGCGCCGAGTTCCAGGTCAACCTCTCGTCTCAAGACTTT
AAGAACCTGCAGGCCGTCTTCGAGCCGGCTGCACGCATCATATACGGCGACAACGCGAGCCCAGATCCAGCAACT
CCCTTCGAAGAGGCGCCTCGAGCGCTGACGAGCGATTCTCACGACCGGATACGATACCGCGGCGATATCCCCGAT
CTCTTCACCGATACCGTCTTTGACGACTCCGAGATGAGCATCAAGTATCTCGTCTTGACCAACACGTGGCCCAAG
TTTATCAAGGAGAGGAGGTCGTTTGATGCGGCCAGCAGCGTTGAGTCTGCCCGGAACTGA
Gene >Ophun1|5246
ATGGGTTCCGAGTTCGGCGTCACGCCCGACACCAAGCCCGAGCTGCGGCTCGATGCCGTCGGCGTCTTCTGGATC
GTCTGGGCCGTCGTCTGGACCATCGTTGTCCTGGCTGGCATGAGCTTTCTCTATGTCCGGCGAGAGATTCCGCTT
CTTCGCATTAGGGGGTTGCCGTTGTCGTTGGCTGCTGTCGCCTTGATGCACTTTTACTGGTTTGCCGTTCAGCTG
GGTTATATCTACGGGCCGTTGATGCCGGAGGTTGCCGAGTACTTCATCATGAGTGTTTGGTTTCCCTTTGGCATT
GCCCTGTTTCATGCTTCCAACAGTCGTTTCCTCTACGTTGCCCGGGCGCAGAAGAAGTACGTTATGAACGCCATC
GACTCGGGCTGGGATCCGGAACGACCGCGGATTCGCAGGACGATGCTGGCTCGTTGGCGGATGCTGGATTATAGC
TACAAGATGCTGCTGCTCGTCGCGTTGGGCATGGGGTTTCAGGTAATAGCCTACAAGACATCCATCTCTGAACGT
GAAACTGACAAGTTGAACAGCTCTTCCTCACGCTCTTCATGTTCATCGTCTCACGCAAGTTTCACTCATCTTTTG
GCATCCCCGGAACCGAAGTCGAGGGCACCTACATGGAGAGAAAGACGGAGCAGGGCCGCGGTTGGGAGTGGTATG
TAACTTGATCGACGAGAAACTCATCAGATGACTGACACGACGAAGGTGGCCGTCCGTATTCTGGCAGATCTTCTG
GGCCTGGATCGTGGCTCCTGTTATCCTGTGGCGAGCTCGTCACCTCCGCGATACTCAGGGCTGGCGAACACAGAC
GATAGCCTGCTGTATAGCAAGGTCAGTTCACGACTTCATCCTTCAAACAAGAGGCTCAATATGCTAACTCAACTC
AGCCTCCACGCTTCTCCCATGTGGCTCATCGCCCTCTACGTCCCCGGCATGGCCCCCGTCAACAACTACTTCATT
CCCCCTCAATGGATCGCCATCTCCATCATGTGCATCGAAATCTTCACCATCTTCATCCCCTGCTGGGAAGTCCGC
AAGCAGCAGGCCCTCTGCCAGGAGACGCTCGACTCCATCGCCCGCTGGGAATCGCGGCAAAAGTCCGCCACTCAC
TGCGGCAAGTCGCTGTCTTCCAGCACGCCCTCGTGGATGCGAAAGGCCGAGTCCATCAGCAGCTCTGGGAACGGT
AGCATCCTCACCATGGACGCGCTGGAGCACACGCTGGCCAAGAACCCTGAACCTCTGCAGCACTTCTCGGCGCTG
AGGGACTTTTCTGGTGAGAATATCGCCTTCTTGACCAGGGTTCGTGAGTGGAGGGCGACGTATCTGGTTCCTGCG
AGCCGGCCTACCACCATAGTCGATGAGAAGAAGCTGGAGACGGACTCGAACGTGTCTACCCTATCGAGGGAGTGT
TTCGAGAGCGCGCTGCTCATCTACATGGACTTTATCAGCAGTAACAGCGCCGAGTTCCAGGTCAACCTCTCGTCT
CAAGACTTTAAGAACCTGCAGGCCGTCTTCGAGCCGGCTGCACGCATCATATACGGCGACAACGCGAGCCCAGAT
CCAGCAACTCCCTTCGAAGAGGCGCCTCGAGCGCTGACGAGCGATTCTCACGACCGGATACGATACCGCGGCGAT
ATCCCCGATCTCTTCACCGATACCGTCTTTGACGACTCCGAGATGAGCATCAAGTATCTCGTCTTGACCAACACG
TGGCCCAAGTTTATCAAGGAGAGGAGGTCGTTTGATGCGGCCAGCAGCGTTGAGTCTGCCCGGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail