Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5244
Gene name
LocationContig_507:2337..4368
Strand+
Gene length (bp)2031
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08159 NUC153 NUC153 domain 1.7E-13 608 636

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06344|ESF1_YEAST Pre-rRNA-processing protein ESF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESF1 PE=1 SV=1 3 651 3.0E-113
sp|O74828|ESF1_SCHPO Pre-rRNA-processing protein esf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esf1 PE=1 SV=1 14 670 1.0E-108
sp|Q756J5|ESF1_ASHGO Pre-rRNA-processing protein ESF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESF1 PE=3 SV=2 170 459 1.0E-74
sp|Q3V1V3|ESF1_MOUSE ESF1 homolog OS=Mus musculus GN=Esf1 PE=1 SV=1 172 648 8.0E-67
sp|Q76MT4|ESF1_RAT ESF1 homolog OS=Rattus norvegicus GN=Esf1 PE=1 SV=1 172 641 2.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06344|ESF1_YEAST Pre-rRNA-processing protein ESF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESF1 PE=1 SV=1 3 651 3.0E-113
sp|O74828|ESF1_SCHPO Pre-rRNA-processing protein esf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esf1 PE=1 SV=1 14 670 1.0E-108
sp|Q756J5|ESF1_ASHGO Pre-rRNA-processing protein ESF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESF1 PE=3 SV=2 170 459 1.0E-74
sp|Q3V1V3|ESF1_MOUSE ESF1 homolog OS=Mus musculus GN=Esf1 PE=1 SV=1 172 648 8.0E-67
sp|Q76MT4|ESF1_RAT ESF1 homolog OS=Rattus norvegicus GN=Esf1 PE=1 SV=1 172 641 2.0E-65
sp|Q9H501|ESF1_HUMAN ESF1 homolog OS=Homo sapiens GN=ESF1 PE=1 SV=1 172 648 7.0E-64
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3953
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5194
Ophiocordyceps australis map64 (Brazil) OphauB2|616
Ophiocordyceps camponoti-floridani Ophcf2|06326
Ophiocordyceps camponoti-rufipedis Ophun1|5244 (this protein)
Ophiocordyceps kimflemingae Ophio5|6796
Ophiocordyceps subramaniannii Hirsu2|7866

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5244
MKPKKDGAPSKGRIADERFANFETDPRYRLPSKKHTKTTIDKRFSGMLVEEDFISNAKVDRYGRQIKSDSKKKAL
ERLYRVESDDEDDGPKTVEPAANDIDDDELVQRQLRAAYDIETRRKRDPAREGGFSCSESDSSSDEDSDDDEGGV
GLASHEEMQRFQDQQAEVESGEVTNRIAIVNLDWDHVKSTDLMALFSSFVPRNMGQITSISIYPSEFGKERMQQE
EIEGPPKALFKNEAKGDADTDDESSSESGDERIKKELIKEGDDQDFDSDALRAYQLDRLRYYYAVMVCSSPETAK
AIYEATDGTEYQASSNFIDLRFIPDEVTFEDEPRDQCTKVPDSYRPVDFVTNALQSSKVKLTWDMHPEEASRKES
IKRAFGGSRNELEENDLRAYLASDTSEDEADSDGGDEAGETKLTKREAARKKMREALGLADEATTKSSKDGPVGE
MEITFAPALADDKAEEAAKEETTIDKYKRKERERKERKRQGAKAEEQSEQKDDEGLGFNDPFFTTDEPAATSKSA
LRKEERRKRREAREAAEAETEALKAKLSGVTTKDADGLEHFDMKDIVRAEKDKGKGRKKKKKSRESAQKDGLMQE
GFEMDLGDDRFQAVFDSHEFAIDPSNPKFKATSGMKQLLEEVREKKRRRGGEDGEGGKKKKRSKTEEERGKKTMK
R*
Coding >Ophun1|5244
ATGAAGCCCAAAAAAGATGGAGCCCCTTCAAAGGGCCGCATCGCTGATGAACGCTTTGCCAACTTCGAGACCGAC
CCTCGCTATCGCCTGCCGTCCAAGAAACACACCAAGACGACCATCGACAAGCGCTTCTCGGGCATGCTCGTGGAA
GAGGACTTTATCTCCAACGCAAAGGTCGACCGCTACGGCCGCCAGATTAAGTCAGATTCCAAGAAGAAGGCTCTC
GAACGGCTGTACCGAGTCGAGAGCGATGACGAAGACGATGGCCCGAAGACGGTGGAGCCAGCCGCCAATGACATT
GACGATGACGAGCTCGTACAGAGACAACTGAGAGCGGCCTACGACATTGAGACTCGGAGAAAGCGCGATCCTGCT
CGTGAAGGAGGCTTTTCCTGCTCCGAGTCCGACTCCAGCTCGGATGAAGATTCGGACGATGACGAGGGAGGCGTT
GGTCTCGCGTCCCACGAGGAGATGCAGCGCTTTCAGGATCAACAGGCTGAAGTGGAGAGCGGCGAAGTCACGAAT
CGGATAGCCATCGTGAATCTGGACTGGGACCACGTCAAGTCGACAGATCTGATGGCTCTATTCTCGAGCTTCGTC
CCTCGCAATATGGGGCAGATTACCAGCATCTCCATCTACCCGAGCGAATTCGGAAAGGAGCGCATGCAACAAGAA
GAGATCGAAGGTCCCCCCAAAGCCCTGTTCAAGAATGAAGCGAAGGGAGATGCCGACACAGACGACGAGAGCAGC
AGCGAGAGCGGCGACGAGAGGATCAAAAAGGAGCTGATCAAGGAGGGCGACGATCAGGACTTTGACAGCGACGCT
CTACGCGCGTACCAGCTGGACCGTCTGCGTTACTATTACGCCGTCATGGTGTGCTCCAGCCCGGAGACGGCAAAG
GCCATTTACGAAGCGACAGACGGAACGGAATACCAGGCATCGTCCAACTTTATCGATCTGCGGTTCATTCCCGAC
GAAGTCACGTTTGAAGACGAGCCCCGAGACCAGTGCACCAAAGTGCCCGACTCGTACAGGCCCGTCGACTTTGTT
ACGAATGCGCTGCAGAGCTCCAAGGTCAAGCTCACGTGGGATATGCACCCGGAGGAAGCGTCGCGCAAGGAGTCG
ATCAAGAGAGCCTTTGGTGGGAGTCGTAACGAGCTGGAGGAGAACGATCTACGGGCTTATCTGGCCAGCGACACC
TCGGAGGACGAGGCCGACAGCGATGGAGGTGACGAAGCGGGCGAGACGAAGCTGACAAAGAGAGAGGCCGCTCGC
AAGAAGATGCGAGAAGCGCTGGGACTCGCCGACGAAGCGACGACTAAGAGCTCCAAGGACGGGCCAGTGGGCGAG
ATGGAGATTACGTTTGCGCCGGCGCTTGCTGATGACAAGGCTGAGGAGGCAGCGAAAGAGGAGACGACAATTGAC
AAGTATAAACGCAAGGAGCGTGAGCGAAAAGAAAGGAAGCGACAGGGGGCCAAGGCTGAAGAGCAGTCGGAGCAG
AAAGACGATGAGGGTCTCGGCTTCAACGACCCGTTCTTTACGACGGACGAGCCGGCTGCAACGTCCAAGTCGGCA
CTGCGAAAGGAAGAGAGGAGGAAGCGACGGGAGGCGCGAGAAGCAGCCGAGGCAGAGACGGAAGCTCTCAAGGCG
AAGCTGTCGGGTGTAACGACAAAGGATGCTGACGGGCTGGAACACTTTGACATGAAGGACATTGTGCGGGCGGAA
AAGGACAAGGGCAAGGGGCGGAAGAAGAAGAAGAAGTCGAGGGAGTCTGCGCAGAAGGATGGGCTGATGCAGGAA
GGGTTCGAGATGGACCTCGGCGACGACCGGTTCCAGGCCGTATTCGACAGCCACGAGTTCGCCATCGATCCGTCC
AATCCCAAGTTCAAGGCGACGAGCGGGATGAAGCAGCTGCTGGAGGAGGTGCGGGAGAAGAAGAGGCGCAGGGGC
GGGGAGGATGGCGAAGGAGGGAAGAAGAAGAAGAGGAGCAAGACCGAGGAGGAAAGGGGAAAGAAGACGATGAAG
AGGTAG
Transcript >Ophun1|5244
ATGAAGCCCAAAAAAGATGGAGCCCCTTCAAAGGGCCGCATCGCTGATGAACGCTTTGCCAACTTCGAGACCGAC
CCTCGCTATCGCCTGCCGTCCAAGAAACACACCAAGACGACCATCGACAAGCGCTTCTCGGGCATGCTCGTGGAA
GAGGACTTTATCTCCAACGCAAAGGTCGACCGCTACGGCCGCCAGATTAAGTCAGATTCCAAGAAGAAGGCTCTC
GAACGGCTGTACCGAGTCGAGAGCGATGACGAAGACGATGGCCCGAAGACGGTGGAGCCAGCCGCCAATGACATT
GACGATGACGAGCTCGTACAGAGACAACTGAGAGCGGCCTACGACATTGAGACTCGGAGAAAGCGCGATCCTGCT
CGTGAAGGAGGCTTTTCCTGCTCCGAGTCCGACTCCAGCTCGGATGAAGATTCGGACGATGACGAGGGAGGCGTT
GGTCTCGCGTCCCACGAGGAGATGCAGCGCTTTCAGGATCAACAGGCTGAAGTGGAGAGCGGCGAAGTCACGAAT
CGGATAGCCATCGTGAATCTGGACTGGGACCACGTCAAGTCGACAGATCTGATGGCTCTATTCTCGAGCTTCGTC
CCTCGCAATATGGGGCAGATTACCAGCATCTCCATCTACCCGAGCGAATTCGGAAAGGAGCGCATGCAACAAGAA
GAGATCGAAGGTCCCCCCAAAGCCCTGTTCAAGAATGAAGCGAAGGGAGATGCCGACACAGACGACGAGAGCAGC
AGCGAGAGCGGCGACGAGAGGATCAAAAAGGAGCTGATCAAGGAGGGCGACGATCAGGACTTTGACAGCGACGCT
CTACGCGCGTACCAGCTGGACCGTCTGCGTTACTATTACGCCGTCATGGTGTGCTCCAGCCCGGAGACGGCAAAG
GCCATTTACGAAGCGACAGACGGAACGGAATACCAGGCATCGTCCAACTTTATCGATCTGCGGTTCATTCCCGAC
GAAGTCACGTTTGAAGACGAGCCCCGAGACCAGTGCACCAAAGTGCCCGACTCGTACAGGCCCGTCGACTTTGTT
ACGAATGCGCTGCAGAGCTCCAAGGTCAAGCTCACGTGGGATATGCACCCGGAGGAAGCGTCGCGCAAGGAGTCG
ATCAAGAGAGCCTTTGGTGGGAGTCGTAACGAGCTGGAGGAGAACGATCTACGGGCTTATCTGGCCAGCGACACC
TCGGAGGACGAGGCCGACAGCGATGGAGGTGACGAAGCGGGCGAGACGAAGCTGACAAAGAGAGAGGCCGCTCGC
AAGAAGATGCGAGAAGCGCTGGGACTCGCCGACGAAGCGACGACTAAGAGCTCCAAGGACGGGCCAGTGGGCGAG
ATGGAGATTACGTTTGCGCCGGCGCTTGCTGATGACAAGGCTGAGGAGGCAGCGAAAGAGGAGACGACAATTGAC
AAGTATAAACGCAAGGAGCGTGAGCGAAAAGAAAGGAAGCGACAGGGGGCCAAGGCTGAAGAGCAGTCGGAGCAG
AAAGACGATGAGGGTCTCGGCTTCAACGACCCGTTCTTTACGACGGACGAGCCGGCTGCAACGTCCAAGTCGGCA
CTGCGAAAGGAAGAGAGGAGGAAGCGACGGGAGGCGCGAGAAGCAGCCGAGGCAGAGACGGAAGCTCTCAAGGCG
AAGCTGTCGGGTGTAACGACAAAGGATGCTGACGGGCTGGAACACTTTGACATGAAGGACATTGTGCGGGCGGAA
AAGGACAAGGGCAAGGGGCGGAAGAAGAAGAAGAAGTCGAGGGAGTCTGCGCAGAAGGATGGGCTGATGCAGGAA
GGGTTCGAGATGGACCTCGGCGACGACCGGTTCCAGGCCGTATTCGACAGCCACGAGTTCGCCATCGATCCGTCC
AATCCCAAGTTCAAGGCGACGAGCGGGATGAAGCAGCTGCTGGAGGAGGTGCGGGAGAAGAAGAGGCGCAGGGGC
GGGGAGGATGGCGAAGGAGGGAAGAAGAAGAAGAGGAGCAAGACCGAGGAGGAAAGGGGAAAGAAGACGATGAAG
AGGTAG
Gene >Ophun1|5244
ATGAAGCCCAAAAAAGATGGAGCCCCTTCAAAGGGCCGCATCGCTGATGAACGCTTTGCCAACTTCGAGACCGAC
CCTCGCTATCGCCTGCCGTCCAAGAAACACACCAAGACGACCATCGACAAGCGCTTCTCGGGCATGCTCGTGGAA
GAGGACTTTATCTCCAACGCAAAGGTCGACCGCTACGGCCGCCAGATTAAGTCAGATTCCAAGAAGAAGGCTCTC
GAACGGCTGTACCGAGTCGAGAGCGATGACGAAGACGATGGCCCGAAGACGGTGGAGCCAGCCGCCAATGACATT
GACGATGACGAGCTCGTACAGAGACAACTGAGAGCGGCCTACGACATTGAGACTCGGAGAAAGCGCGATCCTGCT
CGTGAAGGAGGCTTTTCCTGCTCCGAGTCCGACTCCAGCTCGGATGAAGATTCGGACGATGACGAGGGAGGCGTT
GGTCTCGCGTCCCACGAGGAGATGCAGCGCTTTCAGGATCAACAGGCTGAAGTGGAGAGCGGCGAAGTCACGAAT
CGGATAGCCATCGTGAATCTGGACTGGGACCACGTCAAGTCGACAGATCTGATGGCTCTATTCTCGAGCTTCGTC
CCTCGCAATATGGGGCAGATTACCAGCATCTCCATCTACCCGAGCGAATTCGGAAAGGAGCGCATGCAACAAGAA
GAGATCGAAGGTCCCCCCAAAGCCCTGTTCAAGAATGAAGCGAAGGGAGATGCCGACACAGACGACGAGAGCAGC
AGCGAGAGCGGCGACGAGAGGATCAAAAAGGAGCTGATCAAGGAGGGCGACGATCAGGACTTTGACAGCGACGCT
CTACGCGCGTACCAGCTGGACCGTCTGCGTTACTATTACGCCGTCATGGTGTGCTCCAGCCCGGAGACGGCAAAG
GCCATTTACGAAGCGACAGACGGAACGGAATACCAGGCATCGTCCAACTTTATCGATCTGCGGTTCATTCCCGAC
GAAGTCACGTTTGAAGACGAGCCCCGAGACCAGTGCACCAAAGTGCCCGACTCGTACAGGCCCGTCGACTTTGTT
ACGAATGCGCTGCAGAGCTCCAAGGTCAAGCTCACGTGGGATATGCACCCGGAGGAAGCGTCGCGCAAGGAGTCG
ATCAAGAGAGCCTTTGGTGGGAGTCGTAACGAGCTGGAGGAGAACGATCTACGGGCTTATCTGGCCAGCGACACC
TCGGAGGACGAGGCCGACAGCGATGGAGGTGACGAAGCGGGCGAGACGAAGCTGACAAAGAGAGAGGCCGCTCGC
AAGAAGATGCGAGAAGCGCTGGGACTCGCCGACGAAGCGACGACTAAGAGCTCCAAGGACGGGCCAGTGGGCGAG
ATGGAGATTACGTTTGCGCCGGCGCTTGCTGATGACAAGGCTGAGGAGGCAGCGAAAGAGGAGACGACAATTGAC
AAGTATAAACGCAAGGAGCGTGAGCGAAAAGAAAGGAAGCGACAGGGGGCCAAGGCTGAAGAGCAGTCGGAGCAG
AAAGACGATGAGGGTCTCGGCTTCAACGACCCGTTCTTTACGACGGACGAGCCGGCTGCAACGTCCAAGTCGGCA
CTGCGAAAGGAAGAGAGGAGGAAGCGACGGGAGGCGCGAGAAGCAGCCGAGGCAGAGACGGAAGCTCTCAAGGCG
AAGCTGTCGGGTGTAACGACAAAGGATGCTGACGGGCTGGAACACTTTGACATGAAGGACATTGTGCGGGCGGAA
AAGGACAAGGGCAAGGGGCGGAAGAAGAAGAAGAAGTCGAGGGAGTCTGCGCAGAAGGATGGGCTGATGCAGGAA
GGGTTCGAGATGGACCTCGGCGACGACCGGTTCCAGGCCGTATTCGACAGCCACGAGTTCGCCATCGATCCGTCC
AATCCCAAGTTCAAGGCGACGAGCGGGATGAAGCAGCTGCTGGAGGAGGTGCGGGAGAAGAAGAGGCGCAGGGGC
GGGGAGGATGGCGAAGGAGGGAAGAAGAAGAAGAGGAGCAAGACCGAGGAGGAAAGGGGAAAGAAGACGATGAAG
AGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail