Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5240
Gene name
LocationContig_506:3595..7288
Strand-
Gene length (bp)3693
Transcript length (bp)3693
Coding sequence length (bp)3693
Protein length (aa) 1231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 2.2E-47 99 282
PF08628 Nexin_C Sorting nexin C terminal 4.6E-25 1121 1227
PF00787 PX PX domain 3.0E-17 933 1009
PF00615 RGS Regulator of G protein signaling domain 9.9E-13 418 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 810 1229 4.0E-47
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 782 1229 2.0E-45
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 115 589 4.0E-40
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 27 574 2.0E-22
sp|Q9Y5W8|SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens GN=SNX13 PE=1 SV=4 910 1229 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 810 1229 4.0E-47
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 782 1229 2.0E-45
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 115 589 4.0E-40
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 27 574 2.0E-22
sp|Q9Y5W8|SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens GN=SNX13 PE=1 SV=4 910 1229 3.0E-20
sp|Q6PHS6|SNX13_MOUSE Sorting nexin-13 OS=Mus musculus GN=Snx13 PE=2 SV=1 910 1229 6.0E-20
sp|Q9H3E2|SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens GN=SNX25 PE=1 SV=2 805 1228 5.0E-19
sp|Q3ZT31|SNX25_MOUSE Sorting nexin-25 OS=Mus musculus GN=Snx25 PE=1 SV=3 909 1228 2.0E-17
sp|Q6PHS6|SNX13_MOUSE Sorting nexin-13 OS=Mus musculus GN=Snx13 PE=2 SV=1 85 567 2.0E-14
sp|Q9Y5W8|SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens GN=SNX13 PE=1 SV=4 85 567 1.0E-13
sp|Q5R903|SNX14_PONAB Sorting nexin-14 OS=Pongo abelii GN=SNX14 PE=1 SV=1 98 280 1.0E-11
sp|Q9Y5W7|SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens GN=SNX14 PE=1 SV=3 98 280 1.0E-11
sp|Q8BHY8|SNX14_MOUSE Sorting nexin-14 OS=Mus musculus GN=Snx14 PE=1 SV=2 27 280 1.0E-10
sp|Q5PNP1|SNX14_DANRE Sorting nexin-14 OS=Danio rerio GN=snx14 PE=2 SV=3 27 280 2.0E-10
sp|Q6P4T1|SNX19_MOUSE Sorting nexin-19 OS=Mus musculus GN=Snx19 PE=1 SV=1 112 280 8.0E-08
sp|Q92543|SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens GN=SNX19 PE=1 SV=2 104 280 1.0E-07
sp|Q8C080|SNX16_MOUSE Sorting nexin-16 OS=Mus musculus GN=Snx16 PE=1 SV=2 914 1008 3.0E-07
sp|P57769|SNX16_RAT Sorting nexin-16 OS=Rattus norvegicus GN=Snx16 PE=1 SV=2 914 1008 7.0E-07
sp|P57768|SNX16_HUMAN Sorting nexin-16 OS=Homo sapiens GN=SNX16 PE=1 SV=2 915 1007 7.0E-07
sp|Q5R6Q7|SNX16_PONAB Sorting nexin-16 OS=Pongo abelii GN=SNX16 PE=2 SV=1 915 1007 8.0E-07
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 903 1025 5.0E-06
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 903 1025 5.0E-06
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 903 1025 6.0E-06
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 903 1025 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5240
MALKRRQAVLGVAVAVTACAYAWSPGVRWAIYSFVAGFVVCLVAFVAVIVTTARRPPEKRTLPRVAFLESRRWRV
EVDARHSRQRKHARPPAIDEALLSETVARRLDGLLGLVRRDFICSWYSHISSNAVFPDEVDYCIRQTLVKLIEAA
VRVDLADAVTGRLMPILTAHFRDFNEAERSVRGRKLNRSVTESDELDLAIASKYRQGHLHDAASLSFPDTKTIQQ
DYLRGLVARVMPQLMPEGTHSSRIVSILVREIVACAVLFPVVQLLSDPDTWNQLMESYGRSMLQDRSTVRKLRAA
LDEHARPTTTPRAAKSAVAPRIASGDGERKFEKFIRGIRKVNNLSDARRFRSEVASQLKRDLLEDNQDPVYLRRL
EMGKRLLDQRVDQLAAVGNPSLRSSLATSTISTSSSKLENASLVELLRDSSGLSYFMEYMDRQRLMPLVQFWLVV
DGFRNPLEDDAADEDNDDVDGDDAASASSHLPMWKASDRADLQQIHQAYLSKPELGVPDSTRQEVRQFLKAGSAA
TPAQYHRARQSILKAQSAVLAEMQSRYFQAFKKSDLYYKCLAAQEASSASAARSRAASGQPEQIQQQQQRPPPVR
AAPSYLAKPKSFVRLATSQADSVSTKRSDSASDLRSLGSGDYSAAARRSLDEGPSSPGPLFGDDDAEHESLFGSV
QSLDPNVSGQRVPDTKVVQAVEQALNNIMGDDRPQTAEDLRASLFGADDAESNIFSDRDNGSSRGGSIDAGRPPQ
VAAIAGKDLEKPSISSLGLVSAASRIGVFVDDDLFDDSDRYLPDETDEADGVTGAVDEAEDEVHEAAPGDLGLAE
AIAALTNDIDRLVAQEAVVDSLTNKAELTNNASELRILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTVR
IKSIQVGREDDGREFALYVVEVQRNAGEQMPAASWIVTRRYSEFHDLHQKLRFGYPSVRGLDFPRRRMVMKFQSE
FLRKRSAALEAYLRQLLLLPDVCRSRELRSFLSQSVVAQGQDMTDREDKKDMMTRLYDSVADGMDDILGNIPVLD
HISVAGQNLITAATSQLNSIPPGVSDAHAFPTAAEAEAELNAFEDKELTPFIKPICDIFLEIFGLNRGNNWLRGR
AVVMVLQQLLGGTIERKVRDNVKALVQDDALLRYMDMLTDGLWPDGELRRGREPRSPAARKATRTEASLMLATLV
PDLAGSVVGRANAQAASRRILATLNNARLK*
Coding >Ophun1|5240
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTGTTACCGCCTGTGCCTACGCGTGGTCTCCA
GGCGTCCGTTGGGCCATATACAGTTTCGTCGCCGGCTTCGTCGTCTGCCTCGTCGCCTTTGTCGCTGTGATTGTG
ACGACGGCGCGGAGACCGCCGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGAGAGTCGACGTTGGCGGGTG
GAAGTTGATGCTCGACACAGCCGTCAACGGAAGCATGCCCGACCCCCGGCCATCGATGAAGCGCTCCTCTCCGAG
ACTGTGGCGCGCAGGCTGGATGGCTTGCTGGGATTGGTTCGGCGAGACTTTATCTGCTCTTGGTATTCGCACATC
AGTTCGAATGCCGTCTTCCCAGACGAAGTCGATTATTGTATACGACAGACGCTGGTCAAGCTCATCGAGGCGGCT
GTCCGGGTTGACCTGGCCGACGCCGTCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCGGAGAGGTCGGTTCGTGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGATGAGCTGGACCTGGCCATC
GCCTCCAAGTACCGTCAGGGCCATCTGCACGACGCCGCTTCGCTCTCCTTCCCGGACACCAAGACGATACAGCAG
GATTACCTCCGCGGCTTGGTAGCCCGCGTCATGCCGCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATTGTCGCCTGCGCCGTCCTCTTCCCCGTCGTGCAGCTGCTGTCGGATCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGTTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTTAGGGCTGCG
CTTGATGAGCATGCGCGTCCGACGACGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGC
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGCGGCATCCGCAAGGTCAATAATCTGTCTGATGCTCGTCGGTTC
AGGAGTGAGGTTGCCAGCCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGCTG
GAGATGGGCAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCTGTGGGGAATCCTTCCCTGCGCTCTTCG
CTCGCTACGTCTACCATCTCTACCTCGTCCAGCAAGTTGGAGAATGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGCTTGTCGTACTTCATGGAGTACATGGACCGTCAGCGACTGATGCCGCTGGTTCAGTTCTGGCTGGTTGTC
GATGGCTTTCGGAATCCGTTGGAAGACGACGCGGCTGACGAGGATAACGACGACGTCGACGGTGATGACGCTGCC
TCGGCCTCGTCTCACCTGCCCATGTGGAAGGCCTCGGACCGGGCAGATCTACAGCAGATTCACCAGGCCTACCTG
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCAGCCCAATATCACAGGGCTCGGCAATCTATTCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGATACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCGTCCAGTGCCAGC
GCTGCTCGCTCCCGTGCTGCTTCGGGTCAGCCAGAGCAGATTCAGCAGCAGCAGCAGCGTCCGCCGCCAGTCAGG
GCAGCGCCGTCGTACTTGGCCAAGCCCAAGTCTTTCGTCAGACTGGCAACCTCGCAGGCCGACAGCGTGTCGACG
AAACGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCAGCGGTGACTATTCGGCCGCAGCTCGACGCTCCCTG
GACGAGGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGCTGAGCACGAGAGTCTGTTCGGATCGGTT
CAGAGTCTCGATCCGAACGTGTCAGGGCAACGCGTCCCCGACACCAAGGTGGTGCAGGCCGTGGAGCAGGCACTC
AACAACATCATGGGAGACGACAGGCCGCAGACGGCAGAGGACCTGCGGGCCAGCCTCTTTGGCGCCGACGACGCC
GAGTCCAACATCTTCTCGGACCGCGACAACGGCTCGAGTCGGGGGGGCTCTATAGATGCCGGTAGGCCACCTCAA
GTTGCCGCCATCGCAGGCAAGGACCTCGAGAAGCCCAGCATCTCGTCATTGGGTCTGGTCAGCGCCGCCTCCCGT
ATAGGCGTCTTCGTCGACGACGACCTGTTTGACGATAGCGACAGGTACCTGCCGGACGAGACGGACGAGGCCGAC
GGCGTGACGGGCGCCGTCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGTGATCTTGGTCTGGCCGAA
GCCATTGCGGCCCTGACCAACGACATCGATCGACTGGTGGCACAGGAAGCCGTCGTCGACTCGCTAACCAACAAG
GCCGAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCCAGCCTGCAGCGGGAGATTCGG
CGCAAGGAGCTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGTTCCACCGTCCGC
ATCAAGTCGATACAGGTGGGCAGGGAGGACGACGGGCGCGAGTTTGCGCTGTACGTGGTCGAGGTGCAGCGCAAC
GCGGGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAG
CTGAGGTTCGGCTACCCGTCCGTCAGGGGCCTCGACTTTCCGCGGCGCCGCATGGTGATGAAGTTTCAGAGCGAG
TTCCTCCGCAAGAGGAGTGCGGCCCTCGAGGCCTATCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGCCGCAGC
AGGGAGCTGAGGTCGTTCCTATCGCAGAGCGTCGTGGCTCAGGGCCAAGACATGACGGACCGCGAGGATAAGAAG
GACATGATGACGCGCCTGTACGATTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATACCGGTGCTGGAC
CACATCTCGGTAGCGGGACAGAACCTCATCACAGCGGCCACGAGCCAGCTCAACTCGATACCGCCGGGCGTCAGC
GACGCCCACGCCTTCCCAACGGCCGCCGAGGCAGAAGCCGAGCTCAACGCCTTCGAAGACAAGGAGCTGACGCCC
TTCATCAAACCCATCTGCGACATCTTCCTCGAAATCTTCGGCCTCAACCGCGGAAACAACTGGCTCCGCGGCCGC
GCCGTCGTCATGGTCCTCCAGCAGCTCCTGGGCGGCACCATCGAGCGCAAAGTCCGCGACAACGTCAAAGCCCTG
GTGCAGGACGACGCCCTGCTGCGCTACATGGACATGCTCACCGACGGTCTCTGGCCCGACGGCGAGCTGCGGCGC
GGGCGGGAGCCTCGCTCGCCGGCGGCAAGGAAGGCCACGCGCACCGAGGCGAGCCTCATGCTGGCCACGCTGGTT
CCGGACTTGGCGGGGAGTGTCGTCGGGAGGGCGAATGCGCAGGCGGCTAGTCGGCGGATACTGGCGACTTTGAAT
AATGCTCGGCTTAAGTGA
Transcript >Ophun1|5240
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTGTTACCGCCTGTGCCTACGCGTGGTCTCCA
GGCGTCCGTTGGGCCATATACAGTTTCGTCGCCGGCTTCGTCGTCTGCCTCGTCGCCTTTGTCGCTGTGATTGTG
ACGACGGCGCGGAGACCGCCGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGAGAGTCGACGTTGGCGGGTG
GAAGTTGATGCTCGACACAGCCGTCAACGGAAGCATGCCCGACCCCCGGCCATCGATGAAGCGCTCCTCTCCGAG
ACTGTGGCGCGCAGGCTGGATGGCTTGCTGGGATTGGTTCGGCGAGACTTTATCTGCTCTTGGTATTCGCACATC
AGTTCGAATGCCGTCTTCCCAGACGAAGTCGATTATTGTATACGACAGACGCTGGTCAAGCTCATCGAGGCGGCT
GTCCGGGTTGACCTGGCCGACGCCGTCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCGGAGAGGTCGGTTCGTGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGATGAGCTGGACCTGGCCATC
GCCTCCAAGTACCGTCAGGGCCATCTGCACGACGCCGCTTCGCTCTCCTTCCCGGACACCAAGACGATACAGCAG
GATTACCTCCGCGGCTTGGTAGCCCGCGTCATGCCGCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATTGTCGCCTGCGCCGTCCTCTTCCCCGTCGTGCAGCTGCTGTCGGATCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGTTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTTAGGGCTGCG
CTTGATGAGCATGCGCGTCCGACGACGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGC
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGCGGCATCCGCAAGGTCAATAATCTGTCTGATGCTCGTCGGTTC
AGGAGTGAGGTTGCCAGCCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGCTG
GAGATGGGCAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCTGTGGGGAATCCTTCCCTGCGCTCTTCG
CTCGCTACGTCTACCATCTCTACCTCGTCCAGCAAGTTGGAGAATGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGCTTGTCGTACTTCATGGAGTACATGGACCGTCAGCGACTGATGCCGCTGGTTCAGTTCTGGCTGGTTGTC
GATGGCTTTCGGAATCCGTTGGAAGACGACGCGGCTGACGAGGATAACGACGACGTCGACGGTGATGACGCTGCC
TCGGCCTCGTCTCACCTGCCCATGTGGAAGGCCTCGGACCGGGCAGATCTACAGCAGATTCACCAGGCCTACCTG
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCAGCCCAATATCACAGGGCTCGGCAATCTATTCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGATACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCGTCCAGTGCCAGC
GCTGCTCGCTCCCGTGCTGCTTCGGGTCAGCCAGAGCAGATTCAGCAGCAGCAGCAGCGTCCGCCGCCAGTCAGG
GCAGCGCCGTCGTACTTGGCCAAGCCCAAGTCTTTCGTCAGACTGGCAACCTCGCAGGCCGACAGCGTGTCGACG
AAACGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCAGCGGTGACTATTCGGCCGCAGCTCGACGCTCCCTG
GACGAGGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGCTGAGCACGAGAGTCTGTTCGGATCGGTT
CAGAGTCTCGATCCGAACGTGTCAGGGCAACGCGTCCCCGACACCAAGGTGGTGCAGGCCGTGGAGCAGGCACTC
AACAACATCATGGGAGACGACAGGCCGCAGACGGCAGAGGACCTGCGGGCCAGCCTCTTTGGCGCCGACGACGCC
GAGTCCAACATCTTCTCGGACCGCGACAACGGCTCGAGTCGGGGGGGCTCTATAGATGCCGGTAGGCCACCTCAA
GTTGCCGCCATCGCAGGCAAGGACCTCGAGAAGCCCAGCATCTCGTCATTGGGTCTGGTCAGCGCCGCCTCCCGT
ATAGGCGTCTTCGTCGACGACGACCTGTTTGACGATAGCGACAGGTACCTGCCGGACGAGACGGACGAGGCCGAC
GGCGTGACGGGCGCCGTCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGTGATCTTGGTCTGGCCGAA
GCCATTGCGGCCCTGACCAACGACATCGATCGACTGGTGGCACAGGAAGCCGTCGTCGACTCGCTAACCAACAAG
GCCGAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCCAGCCTGCAGCGGGAGATTCGG
CGCAAGGAGCTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGTTCCACCGTCCGC
ATCAAGTCGATACAGGTGGGCAGGGAGGACGACGGGCGCGAGTTTGCGCTGTACGTGGTCGAGGTGCAGCGCAAC
GCGGGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAG
CTGAGGTTCGGCTACCCGTCCGTCAGGGGCCTCGACTTTCCGCGGCGCCGCATGGTGATGAAGTTTCAGAGCGAG
TTCCTCCGCAAGAGGAGTGCGGCCCTCGAGGCCTATCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGCCGCAGC
AGGGAGCTGAGGTCGTTCCTATCGCAGAGCGTCGTGGCTCAGGGCCAAGACATGACGGACCGCGAGGATAAGAAG
GACATGATGACGCGCCTGTACGATTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATACCGGTGCTGGAC
CACATCTCGGTAGCGGGACAGAACCTCATCACAGCGGCCACGAGCCAGCTCAACTCGATACCGCCGGGCGTCAGC
GACGCCCACGCCTTCCCAACGGCCGCCGAGGCAGAAGCCGAGCTCAACGCCTTCGAAGACAAGGAGCTGACGCCC
TTCATCAAACCCATCTGCGACATCTTCCTCGAAATCTTCGGCCTCAACCGCGGAAACAACTGGCTCCGCGGCCGC
GCCGTCGTCATGGTCCTCCAGCAGCTCCTGGGCGGCACCATCGAGCGCAAAGTCCGCGACAACGTCAAAGCCCTG
GTGCAGGACGACGCCCTGCTGCGCTACATGGACATGCTCACCGACGGTCTCTGGCCCGACGGCGAGCTGCGGCGC
GGGCGGGAGCCTCGCTCGCCGGCGGCAAGGAAGGCCACGCGCACCGAGGCGAGCCTCATGCTGGCCACGCTGGTT
CCGGACTTGGCGGGGAGTGTCGTCGGGAGGGCGAATGCGCAGGCGGCTAGTCGGCGGATACTGGCGACTTTGAAT
AATGCTCGGCTTAAGTGA
Gene >Ophun1|5240
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTGTTACCGCCTGTGCCTACGCGTGGTCTCCA
GGCGTCCGTTGGGCCATATACAGTTTCGTCGCCGGCTTCGTCGTCTGCCTCGTCGCCTTTGTCGCTGTGATTGTG
ACGACGGCGCGGAGACCGCCGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGAGAGTCGACGTTGGCGGGTG
GAAGTTGATGCTCGACACAGCCGTCAACGGAAGCATGCCCGACCCCCGGCCATCGATGAAGCGCTCCTCTCCGAG
ACTGTGGCGCGCAGGCTGGATGGCTTGCTGGGATTGGTTCGGCGAGACTTTATCTGCTCTTGGTATTCGCACATC
AGTTCGAATGCCGTCTTCCCAGACGAAGTCGATTATTGTATACGACAGACGCTGGTCAAGCTCATCGAGGCGGCT
GTCCGGGTTGACCTGGCCGACGCCGTCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCGGAGAGGTCGGTTCGTGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGATGAGCTGGACCTGGCCATC
GCCTCCAAGTACCGTCAGGGCCATCTGCACGACGCCGCTTCGCTCTCCTTCCCGGACACCAAGACGATACAGCAG
GATTACCTCCGCGGCTTGGTAGCCCGCGTCATGCCGCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATTGTCGCCTGCGCCGTCCTCTTCCCCGTCGTGCAGCTGCTGTCGGATCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGTTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTTAGGGCTGCG
CTTGATGAGCATGCGCGTCCGACGACGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGC
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGCGGCATCCGCAAGGTCAATAATCTGTCTGATGCTCGTCGGTTC
AGGAGTGAGGTTGCCAGCCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGCTG
GAGATGGGCAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCTGTGGGGAATCCTTCCCTGCGCTCTTCG
CTCGCTACGTCTACCATCTCTACCTCGTCCAGCAAGTTGGAGAATGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGCTTGTCGTACTTCATGGAGTACATGGACCGTCAGCGACTGATGCCGCTGGTTCAGTTCTGGCTGGTTGTC
GATGGCTTTCGGAATCCGTTGGAAGACGACGCGGCTGACGAGGATAACGACGACGTCGACGGTGATGACGCTGCC
TCGGCCTCGTCTCACCTGCCCATGTGGAAGGCCTCGGACCGGGCAGATCTACAGCAGATTCACCAGGCCTACCTG
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCAGCCCAATATCACAGGGCTCGGCAATCTATTCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGATACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCGTCCAGTGCCAGC
GCTGCTCGCTCCCGTGCTGCTTCGGGTCAGCCAGAGCAGATTCAGCAGCAGCAGCAGCGTCCGCCGCCAGTCAGG
GCAGCGCCGTCGTACTTGGCCAAGCCCAAGTCTTTCGTCAGACTGGCAACCTCGCAGGCCGACAGCGTGTCGACG
AAACGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCAGCGGTGACTATTCGGCCGCAGCTCGACGCTCCCTG
GACGAGGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGCTGAGCACGAGAGTCTGTTCGGATCGGTT
CAGAGTCTCGATCCGAACGTGTCAGGGCAACGCGTCCCCGACACCAAGGTGGTGCAGGCCGTGGAGCAGGCACTC
AACAACATCATGGGAGACGACAGGCCGCAGACGGCAGAGGACCTGCGGGCCAGCCTCTTTGGCGCCGACGACGCC
GAGTCCAACATCTTCTCGGACCGCGACAACGGCTCGAGTCGGGGGGGCTCTATAGATGCCGGTAGGCCACCTCAA
GTTGCCGCCATCGCAGGCAAGGACCTCGAGAAGCCCAGCATCTCGTCATTGGGTCTGGTCAGCGCCGCCTCCCGT
ATAGGCGTCTTCGTCGACGACGACCTGTTTGACGATAGCGACAGGTACCTGCCGGACGAGACGGACGAGGCCGAC
GGCGTGACGGGCGCCGTCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGTGATCTTGGTCTGGCCGAA
GCCATTGCGGCCCTGACCAACGACATCGATCGACTGGTGGCACAGGAAGCCGTCGTCGACTCGCTAACCAACAAG
GCCGAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCCAGCCTGCAGCGGGAGATTCGG
CGCAAGGAGCTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGTTCCACCGTCCGC
ATCAAGTCGATACAGGTGGGCAGGGAGGACGACGGGCGCGAGTTTGCGCTGTACGTGGTCGAGGTGCAGCGCAAC
GCGGGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAG
CTGAGGTTCGGCTACCCGTCCGTCAGGGGCCTCGACTTTCCGCGGCGCCGCATGGTGATGAAGTTTCAGAGCGAG
TTCCTCCGCAAGAGGAGTGCGGCCCTCGAGGCCTATCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGCCGCAGC
AGGGAGCTGAGGTCGTTCCTATCGCAGAGCGTCGTGGCTCAGGGCCAAGACATGACGGACCGCGAGGATAAGAAG
GACATGATGACGCGCCTGTACGATTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATACCGGTGCTGGAC
CACATCTCGGTAGCGGGACAGAACCTCATCACAGCGGCCACGAGCCAGCTCAACTCGATACCGCCGGGCGTCAGC
GACGCCCACGCCTTCCCAACGGCCGCCGAGGCAGAAGCCGAGCTCAACGCCTTCGAAGACAAGGAGCTGACGCCC
TTCATCAAACCCATCTGCGACATCTTCCTCGAAATCTTCGGCCTCAACCGCGGAAACAACTGGCTCCGCGGCCGC
GCCGTCGTCATGGTCCTCCAGCAGCTCCTGGGCGGCACCATCGAGCGCAAAGTCCGCGACAACGTCAAAGCCCTG
GTGCAGGACGACGCCCTGCTGCGCTACATGGACATGCTCACCGACGGTCTCTGGCCCGACGGCGAGCTGCGGCGC
GGGCGGGAGCCTCGCTCGCCGGCGGCAAGGAAGGCCACGCGCACCGAGGCGAGCCTCATGCTGGCCACGCTGGTT
CCGGACTTGGCGGGGAGTGTCGTCGGGAGGGCGAATGCGCAGGCGGCTAGTCGGCGGATACTGGCGACTTTGAAT
AATGCTCGGCTTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail