Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5238
Gene name
LocationContig_506:32..795
Strand+
Gene length (bp)763
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05648 PEX11 Peroxisomal biogenesis factor 11 (PEX11) 1.8E-64 12 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12462|PEX11_YEAST Peroxisomal membrane protein PMP27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX11 PE=1 SV=2 1 235 6.0E-25
sp|Q00316|PX11A_CANBO Peroxisomal membrane protein PMP30A OS=Candida boidinii GN=PEX11A PE=1 SV=1 1 235 1.0E-20
sp|Q00317|PX11B_CANBO Peroxisomal membrane protein PMP30B OS=Candida boidinii GN=PEX11B PE=1 SV=1 1 235 3.0E-18
sp|Q10333|PEX11_SCHPO Peroxisomal biogenesis factor 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex11 PE=3 SV=2 9 232 6.0E-15
sp|Q54H86|PEX11_DICDI Peroxisomal membrane protein 11 homolog OS=Dictyostelium discoideum GN=pex11 PE=3 SV=1 8 234 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12462|PEX11_YEAST Peroxisomal membrane protein PMP27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX11 PE=1 SV=2 1 235 6.0E-25
sp|Q00316|PX11A_CANBO Peroxisomal membrane protein PMP30A OS=Candida boidinii GN=PEX11A PE=1 SV=1 1 235 1.0E-20
sp|Q00317|PX11B_CANBO Peroxisomal membrane protein PMP30B OS=Candida boidinii GN=PEX11B PE=1 SV=1 1 235 3.0E-18
sp|Q10333|PEX11_SCHPO Peroxisomal biogenesis factor 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex11 PE=3 SV=2 9 232 6.0E-15
sp|Q54H86|PEX11_DICDI Peroxisomal membrane protein 11 homolog OS=Dictyostelium discoideum GN=pex11 PE=3 SV=1 8 234 5.0E-10
sp|O75192|PX11A_HUMAN Peroxisomal membrane protein 11A OS=Homo sapiens GN=PEX11A PE=1 SV=1 15 228 2.0E-09
sp|Q148K5|PX11B_BOVIN Peroxisomal membrane protein 11B OS=Bos taurus GN=PEX11B PE=2 SV=1 15 228 9.0E-09
sp|Q9Z211|PX11A_MOUSE Peroxisomal membrane protein 11A OS=Mus musculus GN=Pex11a PE=1 SV=1 15 228 5.0E-07
sp|Q5RFI0|PX11B_PONAB Peroxisomal membrane protein 11B OS=Pongo abelii GN=PEX11B PE=2 SV=1 15 165 1.0E-06
sp|O70597|PX11A_RAT Peroxisomal membrane protein 11A OS=Rattus norvegicus GN=Pex11a PE=1 SV=1 15 228 2.0E-06
sp|O96011|PX11B_HUMAN Peroxisomal membrane protein 11B OS=Homo sapiens GN=PEX11B PE=1 SV=1 15 165 2.0E-06
sp|Q9Z210|PX11B_MOUSE Peroxisomal membrane protein 11B OS=Mus musculus GN=Pex11b PE=1 SV=1 15 164 7.0E-06
sp|Q0VCP2|PX11A_BOVIN Peroxisomal membrane protein 11A OS=Bos taurus GN=PEX11A PE=2 SV=1 15 228 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016559 peroxisome fission Yes
GO:0005779 integral component of peroxisomal membrane Yes
GO:0048285 organelle fission No
GO:0016021 integral component of membrane No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0031300 intrinsic component of organelle membrane No
GO:0005575 cellular_component No
GO:0031231 intrinsic component of peroxisomal membrane No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0031301 integral component of organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 141 160 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5238
MVADALVYHPSLAHYLRFAATTLGRDKLLRTIQYFARFYAWYLLRTNALATRIDPWATLKRHLSLTRRILRLGKP
LEHLQAAAIALDGQRKQHAGFLRYVGVARQLAYAVYLSLDTLALPDALGLVKSPRAPALQRQANRFWAFGIIFSL
AAQLYSLRALRMREARIDRKDGEGVVESKRIAFEKNASQTQLLCDLCDLTIPASALGWVALDDGFVGLAGLCSSL
IGIHSQWNKTA*
Coding >Ophun1|5238
ATGGTCGCCGACGCCCTCGTCTACCACCCCTCCCTCGCCCACTACCTCCGCTTCGCCGCCACAACCCTCGGCCGC
GACAAACTCCTCCGCACAATCCAATACTTCGCCCGCTTCTACGCCTGGTACCTCCTCCGCACCAACGCCCTCGCA
ACCCGAATCGACCCCTGGGCCACCCTCAAGCGCCACCTGTCCCTCACCCGCCGCATCCTCCGCCTCGGCAAGCCC
CTCGAGCACCTGCAAGCCGCCGCCATTGCCCTCGATGGCCAGCGGAAGCAGCATGCCGGATTCCTGCGTTATGTT
GGCGTCGCCAGGCAGCTGGCTTACGCCGTCTACCTCTCGCTCGATACCCTCGCTCTTCCTGATGCCCTTGGCCTG
GTAAAGTCGCCGCGCGCGCCGGCTCTTCAGCGACAGGCAAATCGCTTCTGGGCCTTTGGCATCATCTTCAGCCTC
GCTGCTCAGCTATACTCCCTCCGCGCCCTGCGCATGCGCGAGGCCCGTATCGATCGCAAGGACGGCGAGGGCGTC
GTCGAGAGCAAGCGAATTGCCTTCGAGAAGAACGCCAGCCAGACCCAGCTCCTCTGCGACCTCTGCGACCTCACC
ATCCCGGCCTCTGCCCTCGGCTGGGTCGCCCTCGACGATGGCTTCGTCGGCTTGGCCGGTCTCTGCAGCAGCCTC
ATCGGCATCCACTCCCAATGGAACAAGACCGCCTAG
Transcript >Ophun1|5238
ATGGTCGCCGACGCCCTCGTCTACCACCCCTCCCTCGCCCACTACCTCCGCTTCGCCGCCACAACCCTCGGCCGC
GACAAACTCCTCCGCACAATCCAATACTTCGCCCGCTTCTACGCCTGGTACCTCCTCCGCACCAACGCCCTCGCA
ACCCGAATCGACCCCTGGGCCACCCTCAAGCGCCACCTGTCCCTCACCCGCCGCATCCTCCGCCTCGGCAAGCCC
CTCGAGCACCTGCAAGCCGCCGCCATTGCCCTCGATGGCCAGCGGAAGCAGCATGCCGGATTCCTGCGTTATGTT
GGCGTCGCCAGGCAGCTGGCTTACGCCGTCTACCTCTCGCTCGATACCCTCGCTCTTCCTGATGCCCTTGGCCTG
GTAAAGTCGCCGCGCGCGCCGGCTCTTCAGCGACAGGCAAATCGCTTCTGGGCCTTTGGCATCATCTTCAGCCTC
GCTGCTCAGCTATACTCCCTCCGCGCCCTGCGCATGCGCGAGGCCCGTATCGATCGCAAGGACGGCGAGGGCGTC
GTCGAGAGCAAGCGAATTGCCTTCGAGAAGAACGCCAGCCAGACCCAGCTCCTCTGCGACCTCTGCGACCTCACC
ATCCCGGCCTCTGCCCTCGGCTGGGTCGCCCTCGACGATGGCTTCGTCGGCTTGGCCGGTCTCTGCAGCAGCCTC
ATCGGCATCCACTCCCAATGGAACAAGACCGCCTAG
Gene >Ophun1|5238
ATGGTCGCCGACGCCCTCGTCTACCACCCCTCCCTCGCCCACTACCTCCGCTTCGCCGCCACAACCCTCGGCCGC
GACAAACTCCTCCGCACAATCCAATACTTCGCCCGCTTCTACGCCTGGTACCTCCTCCGCACCAACGCCCTCGCA
ACCCGAATCGACCCCTGGGCCACCCTCAAGCGCCACCTGTCCCTCACCCGCCGCATCCTCCGCCTCGGCAAGCCC
CTCGAGCACCTGCAAGCCGCCGCCATTGCCCTCGATGGCCAGCGGAAGCAGCATGCCGGATTCCTGCGTTATGTT
GGCGTCGCCAGGCAGCTGGCTTACGCCGTCTACCTCTCGCTCGATACCCTCGCTCTTCCTGATGCCCTTGGCCTG
GTAAAGTCGCCGCGCGCGCCGGCTCTTCAGCGACAGGCAAATCGCTTCTGGGCCTTTGGCATCATCTTCAGCCTC
GCTGCTCAGCTATACTCCCTCCGCGCCCTGCGCATGCGCGAGGCCCGTATCGATCGCAAGGACGGCGAGGGCGTC
GTCGAGAGCAAGCGAATTGCCTTGTGAGTCCTTTACTCCCTCCTCCTTCCACTTATACTAACCTCTCCCTCTCAG
CGAGAAGAACGCCAGCCAGACCCAGCTCCTCTGCGACCTCTGCGACCTCACCATCCCGGCCTCTGCCCTCGGCTG
GGTCGCCCTCGACGATGGCTTCGTCGGCTTGGCCGGTCTCTGCAGCAGCCTCATCGGCATCCACTCCCAATGGAA
CAAGACCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail