Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5234
Gene name
LocationContig_505:3788..5972
Strand+
Gene length (bp)2184
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 1.1E-31 95 208

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 117 139 22
3 178 200 22
4 620 642 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5234
MENQHTASSSEIEPRPTNKGSGNYHPASSSDTEPRPTGIGNQHTASSSDTELRPAEADGTAKTQRRPWQKLRNIY
PWFPEIAALFAAAALVAAIVIILLGFDGQQLPQWPYSINLNTLIALLTLCLRTALALVAAEIISQSKWMWFSDKP
RSLAGFQTFDEASRGLLGSFKLISLLRLSWRGSPLAVMAAITSILSLAISPFAQQAIKTFSCPRVVSSDGARIPV
AMHLPGEDSGYWYASTLGYKTQGAIFSGLTNPSGNESNIQVQCSTGNCTFPETLGVPHSTIGLCARCLDTTSLVK
VSERVDPEDRSLTRGKNSSVAMLNDMMLSVKDYGSILKARSEVNYNLSFADSLMTPEFDEIAAKSSIANFSIMTF
TELKDQHCRNGTLNASCVVAASCSLYPCMKKFRASVVNGRIQESIVEEVPSETNRTDLPADNYDYHHDRVMIKSP
CLVNGQIYDETNFSSIRAEDVMGGARTIPVYVKRRDSSGRSRTTNMNVPYDCLYTVDGHYVIKLARFVHEQLFSG
SCTTHEYMERGSLDCNQTWWLHQLYNHGNSSYDFINNAVQEMVKATTNFYRIEGWNPGYEKTYRGVSPFPTEFPK
AFIKGKIQESTVCMRLEKPWLLLPVILCLTTIALLAAMVFVNATHSHPPVWKSSALPLLFFGLDGRAPHREEASD
GPCADDLASMGRQAKRTTVYLDADGGLSRTALVALDGADWGDSNERLREEMS*
Coding >Ophun1|5234
ATGGAGAATCAGCACACGGCATCCTCCTCAGAGATTGAGCCACGGCCTACGAATAAAGGGTCCGGCAATTACCAC
CCAGCATCCTCCTCAGATACAGAGCCACGGCCTACAGGCATCGGGAATCAGCATACGGCATCCTCCTCAGACACA
GAGCTACGGCCTGCAGAGGCCGACGGCACGGCCAAGACTCAAAGACGACCATGGCAAAAATTGAGAAATATTTAC
CCCTGGTTCCCTGAAATTGCCGCCCTCTTCGCTGCAGCAGCTCTCGTGGCCGCCATCGTCATCATCCTACTCGGG
TTCGACGGCCAGCAACTCCCGCAATGGCCGTACAGCATCAACCTCAATACGCTCATCGCCCTGCTCACCCTCTGC
CTCCGCACTGCCCTCGCGCTTGTCGCGGCCGAAATCATCAGCCAATCGAAATGGATGTGGTTCTCCGACAAGCCG
CGGTCGCTGGCCGGCTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCTTCAAGCTGATATCCCTC
TTACGCCTCAGCTGGCGCGGCAGCCCCCTTGCAGTCATGGCCGCCATCACATCCATCCTTAGTCTAGCCATCAGT
CCCTTCGCTCAGCAAGCCATCAAGACGTTTTCCTGCCCCCGTGTGGTCTCATCAGACGGCGCCAGGATCCCGGTG
GCCATGCACCTCCCCGGAGAGGACTCAGGGTATTGGTACGCCTCAACGCTGGGGTACAAGACCCAGGGCGCCATT
TTCTCGGGCCTCACGAATCCGAGTGGCAACGAGAGCAACATACAGGTTCAGTGTTCGACGGGTAACTGCACCTTT
CCCGAGACACTTGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCGGTGCCTGGACACGACTTCGCTTGTGAAA
GTCTCTGAACGAGTCGACCCTGAAGACCGTTCGCTAACTCGCGGAAAAAACTCGTCGGTAGCCATGCTTAACGAC
ATGATGCTTAGCGTCAAGGACTACGGATCGATACTCAAGGCGAGGTCAGAAGTGAATTATAACCTGTCCTTCGCA
GATTCTCTCATGACTCCCGAATTTGATGAGATTGCTGCTAAGAGTTCCATTGCCAACTTCTCCATCATGACATTC
ACCGAACTCAAAGACCAACACTGTCGCAACGGCACCCTCAATGCGTCGTGTGTTGTGGCCGCTTCCTGCTCGCTC
TATCCCTGCATGAAGAAATTCCGAGCCAGCGTCGTCAACGGCCGGATACAAGAGTCCATCGTGGAAGAGGTCCCG
TCTGAGACCAATAGAACGGACTTGCCGGCGGATAATTACGATTACCATCATGATCGTGTCATGATCAAAAGCCCT
TGCCTAGTCAATGGCCAGATTTACGACGAGACCAACTTCTCCTCAATACGGGCCGAGGATGTAATGGGAGGAGCC
AGAACGATTCCCGTCTACGTCAAAAGAAGAGACTCGTCGGGCCGGTCCAGAACGACAAACATGAATGTGCCTTAC
GACTGCTTGTATACTGTCGATGGCCACTACGTGATCAAGCTCGCACGATTCGTCCATGAGCAGCTCTTCTCCGGC
TCCTGCACTACACACGAATATATGGAAAGGGGAAGCTTGGACTGCAACCAAACCTGGTGGCTTCACCAGCTCTAT
AACCACGGCAACTCGTCCTACGACTTCATCAACAACGCTGTCCAAGAGATGGTAAAGGCCACGACCAACTTCTAC
CGGATAGAGGGATGGAATCCCGGTTATGAAAAGACATATCGCGGTGTCAGCCCCTTCCCCACCGAGTTCCCCAAA
GCCTTCATCAAGGGTAAGATTCAGGAAAGCACCGTCTGCATGCGCCTCGAAAAGCCCTGGCTTCTGCTCCCCGTG
ATACTCTGCCTCACGACGATAGCCCTCCTAGCCGCCATGGTTTTCGTCAACGCCACACACAGCCACCCACCCGTC
TGGAAGTCGAGCGCGCTTCCTCTCTTGTTCTTTGGCCTCGACGGCCGGGCCCCGCACAGAGAGGAGGCGTCGGAT
GGGCCGTGTGCCGATGATCTTGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGTTTACTTGGATGCGGATGGT
GGGTTGTCCCGGACAGCCTTGGTGGCCTTGGATGGAGCCGACTGGGGAGACAGCAATGAGAGGTTGAGAGAAGAG
ATGTCGTGA
Transcript >Ophun1|5234
ATGGAGAATCAGCACACGGCATCCTCCTCAGAGATTGAGCCACGGCCTACGAATAAAGGGTCCGGCAATTACCAC
CCAGCATCCTCCTCAGATACAGAGCCACGGCCTACAGGCATCGGGAATCAGCATACGGCATCCTCCTCAGACACA
GAGCTACGGCCTGCAGAGGCCGACGGCACGGCCAAGACTCAAAGACGACCATGGCAAAAATTGAGAAATATTTAC
CCCTGGTTCCCTGAAATTGCCGCCCTCTTCGCTGCAGCAGCTCTCGTGGCCGCCATCGTCATCATCCTACTCGGG
TTCGACGGCCAGCAACTCCCGCAATGGCCGTACAGCATCAACCTCAATACGCTCATCGCCCTGCTCACCCTCTGC
CTCCGCACTGCCCTCGCGCTTGTCGCGGCCGAAATCATCAGCCAATCGAAATGGATGTGGTTCTCCGACAAGCCG
CGGTCGCTGGCCGGCTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCTTCAAGCTGATATCCCTC
TTACGCCTCAGCTGGCGCGGCAGCCCCCTTGCAGTCATGGCCGCCATCACATCCATCCTTAGTCTAGCCATCAGT
CCCTTCGCTCAGCAAGCCATCAAGACGTTTTCCTGCCCCCGTGTGGTCTCATCAGACGGCGCCAGGATCCCGGTG
GCCATGCACCTCCCCGGAGAGGACTCAGGGTATTGGTACGCCTCAACGCTGGGGTACAAGACCCAGGGCGCCATT
TTCTCGGGCCTCACGAATCCGAGTGGCAACGAGAGCAACATACAGGTTCAGTGTTCGACGGGTAACTGCACCTTT
CCCGAGACACTTGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCGGTGCCTGGACACGACTTCGCTTGTGAAA
GTCTCTGAACGAGTCGACCCTGAAGACCGTTCGCTAACTCGCGGAAAAAACTCGTCGGTAGCCATGCTTAACGAC
ATGATGCTTAGCGTCAAGGACTACGGATCGATACTCAAGGCGAGGTCAGAAGTGAATTATAACCTGTCCTTCGCA
GATTCTCTCATGACTCCCGAATTTGATGAGATTGCTGCTAAGAGTTCCATTGCCAACTTCTCCATCATGACATTC
ACCGAACTCAAAGACCAACACTGTCGCAACGGCACCCTCAATGCGTCGTGTGTTGTGGCCGCTTCCTGCTCGCTC
TATCCCTGCATGAAGAAATTCCGAGCCAGCGTCGTCAACGGCCGGATACAAGAGTCCATCGTGGAAGAGGTCCCG
TCTGAGACCAATAGAACGGACTTGCCGGCGGATAATTACGATTACCATCATGATCGTGTCATGATCAAAAGCCCT
TGCCTAGTCAATGGCCAGATTTACGACGAGACCAACTTCTCCTCAATACGGGCCGAGGATGTAATGGGAGGAGCC
AGAACGATTCCCGTCTACGTCAAAAGAAGAGACTCGTCGGGCCGGTCCAGAACGACAAACATGAATGTGCCTTAC
GACTGCTTGTATACTGTCGATGGCCACTACGTGATCAAGCTCGCACGATTCGTCCATGAGCAGCTCTTCTCCGGC
TCCTGCACTACACACGAATATATGGAAAGGGGAAGCTTGGACTGCAACCAAACCTGGTGGCTTCACCAGCTCTAT
AACCACGGCAACTCGTCCTACGACTTCATCAACAACGCTGTCCAAGAGATGGTAAAGGCCACGACCAACTTCTAC
CGGATAGAGGGATGGAATCCCGGTTATGAAAAGACATATCGCGGTGTCAGCCCCTTCCCCACCGAGTTCCCCAAA
GCCTTCATCAAGGGTAAGATTCAGGAAAGCACCGTCTGCATGCGCCTCGAAAAGCCCTGGCTTCTGCTCCCCGTG
ATACTCTGCCTCACGACGATAGCCCTCCTAGCCGCCATGGTTTTCGTCAACGCCACACACAGCCACCCACCCGTC
TGGAAGTCGAGCGCGCTTCCTCTCTTGTTCTTTGGCCTCGACGGCCGGGCCCCGCACAGAGAGGAGGCGTCGGAT
GGGCCGTGTGCCGATGATCTTGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGTTTACTTGGATGCGGATGGT
GGGTTGTCCCGGACAGCCTTGGTGGCCTTGGATGGAGCCGACTGGGGAGACAGCAATGAGAGGTTGAGAGAAGAG
ATGTCGTGA
Gene >Ophun1|5234
ATGGAGAATCAGCACACGGCATCCTCCTCAGAGATTGAGCCACGGCCTACGAATAAAGGGTCCGGCAATTACCAC
CCAGCATCCTCCTCAGATACAGAGCCACGGCCTACAGGCATCGGGAATCAGCATACGGCATCCTCCTCAGACACA
GAGCTACGGCCTGCAGAGGCCGACGGCACGGCCAAGACTCAAAGACGACCATGGCAAAAATTGAGAAATATTTAC
CCCTGGTTCCCTGAAATTGCCGCCCTCTTCGCTGCAGCAGCTCTCGTGGCCGCCATCGTCATCATCCTACTCGGG
TTCGACGGCCAGCAACTCCCGCAATGGCCGTACAGCATCAACCTCAATACGCTCATCGCCCTGCTCACCCTCTGC
CTCCGCACTGCCCTCGCGCTTGTCGCGGCCGAAATCATCAGCCAATCGAAATGGATGTGGTTCTCCGACAAGCCG
CGGTCGCTGGCCGGCTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCTTCAAGCTGATATCCCTC
TTACGCCTCAGCTGGCGCGGCAGCCCCCTTGCAGTCATGGCCGCCATCACATCCATCCTTAGTCTAGCCATCAGT
CCCTTCGCTCAGCAAGCCATCAAGACGTTTTCCTGCCCCCGTGTGGTCTCATCAGACGGCGCCAGGATCCCGGTG
GCCATGCACCTCCCCGGAGAGGACTCAGGGTATTGGTACGCCTCAACGCTGGGGTACAAGACCCAGGGCGCCATT
TTCTCGGGCCTCACGAATCCGAGTGGCAACGAGAGCAACATACAGGTTCAGTGTTCGACGGGTAACTGCACCTTT
CCCGAGACACTTGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCGGTGCCTGGACACGACTTCGCTTGTGAAA
GTCTCTGAACGAGTCGACCCTGAAGACCGTTCGCTAACTCGCGGAAAAAACTCGTCGGTAGCCATGCTTAACGAC
ATGATGCTTAGCGTCAAGGACTACGGATCGATACTCAAGGCGAGGTCAGAAGTGAATTATAACCTGTCCTTCGCA
GATTCTCTCATGACTCCCGAATTTGATGAGATTGCTGCTAAGAGTTCCATTGCCAACTTCTCCATCATGACATTC
ACCGAACTCAAAGACCAACACTGTCGCAACGGCACCCTCAATGCGTCGTGTGTTGTGGCCGCTTCCTGCTCGCTC
TATCCCTGCATGAAGAAATTCCGAGCCAGCGTCGTCAACGGCCGGATACAAGAGTCCATCGTGGAAGAGGTCCCG
TCTGAGACCAATAGAACGGACTTGCCGGCGGATAATTACGATTACCATCATGATCGTGTCATGATCAAAAGCCCT
TGCCTAGTCAATGGCCAGATTTACGACGAGACCAACTTCTCCTCAATACGGGCCGAGGATGTAATGGGAGGAGCC
AGAACGATTCCCGTCTACGTCAAAAGAAGAGACTCGTCGGGCCGGTCCAGAACGACAAACATGAATGTGCCTTAC
GACTGCTTGTATACTGTCGATGGCCACTACGTGATCAAGCTCGCACGATTCGTCCATGAGCAGCTCTTCTCCGGC
TCCTGCACTACACACGAATATATGGAAAGGGGAAGCTTGGACTGCAACCAAACCTGGTGGCTTCACCAGCTCTAT
AACCACGGCAACTCGTCCTACGACTTCATCAACAACGCTGTCCAAGAGATGGTAAAGGCCACGACCAACTTCTAC
CGGATAGAGGGATGGAATCCCGGTTATGAAAAGACATATCGCGGTGTCAGCCCCTTCCCCACCGAGTTCCCCAAA
GCCTTCATCAAGGGTAAGATTCAGGAAAGCACCGTCTGCATGCGCCTCGAAAAGCCCTGGCTTCTGCTCCCCGTG
ATACTCTGCCTCACGACGATAGCCCTCCTAGCCGCCATGGTTTTCGTCAACGCCACACACAGCCACCCACCCGTC
TGGAAGTCGAGCGCGCTTCCTCTCTTGTTCTTTGGCCTCGACGGCCGGGCCCCGCACAGAGAGGAGGCGTCGGAT
GGGCCGTGTGCCGATGATCTTGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGTTTACTTGGATGCGGATGGT
GGGTTGTCCCGGACAGCCTTGGTGGCCTTGGATGGAGCCGACTGGGGAGACAGCAATGAGAGGTTGAGAGAAGAG
ATGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail