Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5233
Gene name
LocationContig_505:47..2737
Strand-
Gene length (bp)2690
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12348 CLASP_N CLASP N terminal 2.1E-43 8 220
PF12348 CLASP_N CLASP N terminal 1.0E-88 279 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S9|STU1_CHAGB Protein STU1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=STU1 PE=3 SV=1 6 722 0.0E+00
sp|Q7S9L2|STU1_NEUCR Protein stu-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stu-1 PE=3 SV=1 5 682 0.0E+00
sp|Q4I9B7|STU1_GIBZE Protein STU1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=STU1 PE=3 SV=1 1 717 0.0E+00
sp|Q2UCC9|STU1_ASPOR Protein stu1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=stu1 PE=3 SV=2 14 659 8.0E-166
sp|Q0UQJ8|STU1_PHANO Protein STU1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STU1 PE=3 SV=1 6 715 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S9|STU1_CHAGB Protein STU1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=STU1 PE=3 SV=1 6 722 0.0E+00
sp|Q7S9L2|STU1_NEUCR Protein stu-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stu-1 PE=3 SV=1 5 682 0.0E+00
sp|Q4I9B7|STU1_GIBZE Protein STU1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=STU1 PE=3 SV=1 1 717 0.0E+00
sp|Q2UCC9|STU1_ASPOR Protein stu1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=stu1 PE=3 SV=2 14 659 8.0E-166
sp|Q0UQJ8|STU1_PHANO Protein STU1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STU1 PE=3 SV=1 6 715 3.0E-138
sp|Q1DS65|STU1_COCIM Protein STU1 OS=Coccidioides immitis (strain RS) GN=STU1 PE=3 SV=2 245 641 2.0E-122
sp|Q4WSI0|STU1_ASPFU Protein stu1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=stu1 PE=3 SV=2 265 635 3.0E-113
sp|Q4P5R8|STU1_USTMA Protein STU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=STU1 PE=3 SV=2 8 502 1.0E-63
sp|Q6C882|STU1_YARLI Protein STU1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STU1 PE=3 SV=2 20 506 1.0E-61
sp|P0CM74|STU1_CRYNJ Protein STU1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=STU1 PE=3 SV=1 131 514 3.0E-56
sp|P0CM75|STU1_CRYNB Protein STU1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=STU1 PE=3 SV=1 131 514 3.0E-56
sp|Q1DS65|STU1_COCIM Protein STU1 OS=Coccidioides immitis (strain RS) GN=STU1 PE=3 SV=2 8 228 1.0E-52
sp|Q4WSI0|STU1_ASPFU Protein stu1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=stu1 PE=3 SV=2 10 263 6.0E-50
sp|O42874|STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=peg1 PE=1 SV=1 6 509 6.0E-50
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 268 649 1.0E-49
sp|Q59WD5|STU1_CANAL Protein STU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=STU1 PE=3 SV=1 1 548 2.0E-49
sp|Q6BK07|STU1_DEBHA Protein STU1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STU1 PE=3 SV=2 290 548 5.0E-40
sp|Q75B70|STU1_ASHGO Protein STU1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STU1 PE=3 SV=2 27 484 1.0E-33
sp|Q6CVG0|STU1_KLULA Protein STU1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STU1 PE=3 SV=1 173 523 9.0E-32
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 8 228 6.0E-29
sp|Q9NBD7|CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster GN=chb PE=1 SV=1 50 507 2.0E-21
sp|Q7Z460|CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens GN=CLASP1 PE=1 SV=1 51 513 1.0E-20
sp|A1A5K2|CLA1B_XENLA CLIP-associating protein 1-B OS=Xenopus laevis GN=clasp1b PE=1 SV=1 51 513 2.0E-19
sp|P38198|STU1_YEAST Protein STU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STU1 PE=1 SV=1 293 494 5.0E-19
sp|Q80TV8|CLAP1_MOUSE CLIP-associating protein 1 OS=Mus musculus GN=Clasp1 PE=1 SV=2 294 513 1.0E-14
sp|Q99JD4|CLAP2_RAT CLIP-associating protein 2 OS=Rattus norvegicus GN=Clasp2 PE=1 SV=1 268 504 3.0E-14
sp|Q8BRT1|CLAP2_MOUSE CLIP-associating protein 2 OS=Mus musculus GN=Clasp2 PE=1 SV=1 273 504 4.0E-14
sp|O75122|CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens GN=CLASP2 PE=1 SV=2 268 504 4.0E-14
sp|Q4U0G1|CLA1A_XENLA CLIP-associating protein 1-A OS=Xenopus laevis GN=clasp1-a PE=2 SV=2 294 513 1.0E-13
sp|Q6NYW6|CLAP2_DANRE CLIP-associating protein 2 OS=Danio rerio GN=clasp2 PE=2 SV=1 273 504 3.0E-13
sp|Q8RWY6|CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana GN=CLASP PE=1 SV=1 100 507 4.0E-13
sp|Q6BK07|STU1_DEBHA Protein STU1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STU1 PE=3 SV=2 25 231 3.0E-11
sp|Q54VQ0|Y6442_DICDI Uncharacterized protein DDB_G0280205 OS=Dictyostelium discoideum GN=DDB_G0280205 PE=4 SV=2 270 504 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2404
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6556
Ophiocordyceps australis map64 (Brazil) OphauB2|4656
Ophiocordyceps camponoti-floridani Ophcf2|02856
Ophiocordyceps camponoti-rufipedis Ophun1|5233 (this protein)
Ophiocordyceps kimflemingae Ophio5|6457
Ophiocordyceps subramaniannii Hirsu2|3398

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5233
MADTKLTDQQVADLTALLRSDASFDVKVQRVTAVKSGIKQHNVPEASAPLLFDGLRLASSSQHAALVNAGFTALN
HLVTRLSRQEPRLLAKEAPRTLSVIIDRFGDHKDKFRALASQALTTLYVVAPVDVERAIRNQAMVGKNSRAKEAA
MQWLLQMHREQGLQFRAYVPLLMELLEDADGNVRDAAKSTVIELFKTAPNAAKSDLRRQLKNFKVRPAIEQAIVK
TLGPTGRPETPSDARPVNLTASVSSLTSERATTPVTESPAEAVEPMYVNTHRELEDLFRGMAGHFDGKETEQNWM
KREQSMSTLRKLMAGNAPADFADAFLTGLRAMLDGIIKAVNSLRTSLSKEGCGLVQDMAVTLGPAMDPMVELLMQ
TLVKLSAGTKKISSQLANVTVDTIIARVTYTGRLMQHVWGACQDKNVQPRLYATGWLKTLLKKEGHHKSHVEHGG
GVDMMEKCIKKGLGDANPGVREKMRSTYWAFWAVWPAKADAIMADLDPTAQKLLNKDPNNPNSPNKGAEAARPGL
GLSKSTMAAGKPSVREAMMAQRRANMAAKNLPPRPGSAMAHISPVRSTSNSLAKTVPATTRTRQEPTISVNAGGM
SVAPMRPARRRPEVARPATAGPYSVREHPAMEAASPESAESTPRRVQEPTPKRTTQRPRLAAVDTNGASASSPRS
ASKIPSPRGSPPTRQARSATTGASPSVSPKAYEDLTMVVPEMPSIAATLTRKKTADELKMQSQEVMPVRSVPETE
GEAHETPSKEIKSPVIDKAVTEVKSPEEETLAKDIKLPQEEIPATEINNPPSKSSKTPSKKIPPIQPQP*
Coding >Ophun1|5233
ATGGCCGACACCAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCGCGTCACCGCCGTCAAGTCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCCCTC
CTCTTCGACGGCTTGCGCCTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAACGCCGGCTTTACCGCCCTCAAC
CACCTCGTCACCCGACTCTCGCGTCAGGAGCCCCGTCTTCTCGCAAAGGAGGCGCCCCGTACGCTGTCCGTCATC
ATCGACAGGTTCGGCGACCACAAGGACAAGTTTCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTACGTTGTC
GCTCCTGTCGACGTCGAGCGCGCCATCAGGAACCAGGCCATGGTCGGCAAGAATTCGAGAGCCAAGGAAGCGGCC
ATGCAGTGGCTTTTGCAGATGCATCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTCCCTCTTCTCATGGAGCTG
CTCGAGGACGCTGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGACCGCTCCCAAC
GCCGCCAAGTCAGATCTCCGGCGACAACTGAAAAACTTCAAGGTACGACCTGCCATCGAGCAGGCCATCGTCAAG
ACGCTCGGCCCTACCGGTCGGCCGGAAACGCCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCCTCC
CTCACGAGCGAGCGCGCAACTACCCCCGTGACTGAGTCTCCCGCCGAGGCCGTCGAGCCCATGTACGTCAACACG
CACCGCGAGCTCGAAGACTTGTTCCGCGGCATGGCCGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGGATG
AAGCGAGAGCAGTCGATGAGCACCCTGCGCAAGCTCATGGCCGGAAACGCGCCAGCCGACTTCGCCGACGCCTTT
CTGACCGGTCTACGCGCCATGCTGGATGGCATCATCAAGGCCGTCAACTCGCTGCGCACCAGTCTGTCCAAGGAA
GGCTGCGGCCTCGTCCAAGACATGGCGGTGACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTTTTGATGCAG
ACGCTCGTAAAGCTCTCGGCCGGCACCAAGAAGATAAGCTCGCAACTGGCAAACGTGACCGTCGACACCATCATC
GCCCGCGTCACGTACACGGGCCGGCTGATGCAGCACGTCTGGGGCGCCTGTCAGGACAAGAACGTGCAGCCGAGG
TTGTATGCCACGGGCTGGCTCAAGACGCTACTCAAGAAGGAGGGTCATCACAAGAGCCACGTCGAGCATGGGGGT
GGCGTCGACATGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCGAATCCCGGCGTGAGGGAGAAGATGAGG
TCGACCTACTGGGCCTTTTGGGCCGTGTGGCCAGCCAAAGCCGATGCCATCATGGCCGACCTGGACCCGACAGCC
CAGAAGCTCCTCAACAAGGATCCAAACAACCCCAACTCACCCAACAAGGGCGCCGAAGCCGCTCGCCCCGGTCTT
GGCCTGTCCAAGAGCACCATGGCGGCCGGCAAGCCCAGCGTGCGCGAAGCCATGATGGCACAGAGGAGGGCCAAC
ATGGCGGCCAAGAACCTGCCACCGCGTCCGGGATCGGCCATGGCGCACATCTCCCCCGTGCGCTCCACGTCCAAC
TCGCTGGCCAAGACGGTGCCCGCGACTACGCGAACGCGCCAGGAGCCCACCATCTCGGTCAACGCCGGCGGCATG
TCGGTGGCCCCCATGCGGCCCGCCAGGAGGAGGCCCGAAGTGGCTCGACCGGCGACGGCGGGACCCTACTCGGTG
CGAGAGCATCCGGCCATGGAAGCCGCCAGCCCGGAGAGCGCCGAGTCTACGCCCAGGAGAGTCCAGGAGCCGACA
CCGAAGCGGACGACGCAGCGGCCGCGGCTGGCGGCGGTAGACACAAACGGCGCGTCGGCCTCATCGCCAAGGTCA
GCGTCCAAGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCAGGCTAGAAGCGCCACGACGGGTGCCTCTCCC
TCGGTGTCGCCCAAGGCGTACGAGGACCTGACCATGGTGGTTCCGGAGATGCCCAGCATAGCGGCGACGTTGACG
CGCAAGAAGACGGCGGATGAGCTGAAGATGCAGTCTCAGGAGGTGATGCCGGTGCGGTCTGTTCCCGAGACGGAG
GGCGAGGCTCACGAGACGCCGTCCAAGGAGATCAAGTCGCCCGTCATCGACAAGGCCGTCACGGAAGTAAAGTCC
CCCGAGGAAGAGACGCTGGCCAAGGATATCAAGCTGCCTCAGGAAGAGATCCCGGCCACAGAAATCAACAACCCA
CCCTCAAAGTCTTCGAAGACCCCTTCAAAGAAGATCCCCCCCATCCAACCCCAACCATGA
Transcript >Ophun1|5233
ATGGCCGACACCAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCGCGTCACCGCCGTCAAGTCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCCCTC
CTCTTCGACGGCTTGCGCCTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAACGCCGGCTTTACCGCCCTCAAC
CACCTCGTCACCCGACTCTCGCGTCAGGAGCCCCGTCTTCTCGCAAAGGAGGCGCCCCGTACGCTGTCCGTCATC
ATCGACAGGTTCGGCGACCACAAGGACAAGTTTCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTACGTTGTC
GCTCCTGTCGACGTCGAGCGCGCCATCAGGAACCAGGCCATGGTCGGCAAGAATTCGAGAGCCAAGGAAGCGGCC
ATGCAGTGGCTTTTGCAGATGCATCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTCCCTCTTCTCATGGAGCTG
CTCGAGGACGCTGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGACCGCTCCCAAC
GCCGCCAAGTCAGATCTCCGGCGACAACTGAAAAACTTCAAGGTACGACCTGCCATCGAGCAGGCCATCGTCAAG
ACGCTCGGCCCTACCGGTCGGCCGGAAACGCCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCCTCC
CTCACGAGCGAGCGCGCAACTACCCCCGTGACTGAGTCTCCCGCCGAGGCCGTCGAGCCCATGTACGTCAACACG
CACCGCGAGCTCGAAGACTTGTTCCGCGGCATGGCCGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGGATG
AAGCGAGAGCAGTCGATGAGCACCCTGCGCAAGCTCATGGCCGGAAACGCGCCAGCCGACTTCGCCGACGCCTTT
CTGACCGGTCTACGCGCCATGCTGGATGGCATCATCAAGGCCGTCAACTCGCTGCGCACCAGTCTGTCCAAGGAA
GGCTGCGGCCTCGTCCAAGACATGGCGGTGACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTTTTGATGCAG
ACGCTCGTAAAGCTCTCGGCCGGCACCAAGAAGATAAGCTCGCAACTGGCAAACGTGACCGTCGACACCATCATC
GCCCGCGTCACGTACACGGGCCGGCTGATGCAGCACGTCTGGGGCGCCTGTCAGGACAAGAACGTGCAGCCGAGG
TTGTATGCCACGGGCTGGCTCAAGACGCTACTCAAGAAGGAGGGTCATCACAAGAGCCACGTCGAGCATGGGGGT
GGCGTCGACATGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCGAATCCCGGCGTGAGGGAGAAGATGAGG
TCGACCTACTGGGCCTTTTGGGCCGTGTGGCCAGCCAAAGCCGATGCCATCATGGCCGACCTGGACCCGACAGCC
CAGAAGCTCCTCAACAAGGATCCAAACAACCCCAACTCACCCAACAAGGGCGCCGAAGCCGCTCGCCCCGGTCTT
GGCCTGTCCAAGAGCACCATGGCGGCCGGCAAGCCCAGCGTGCGCGAAGCCATGATGGCACAGAGGAGGGCCAAC
ATGGCGGCCAAGAACCTGCCACCGCGTCCGGGATCGGCCATGGCGCACATCTCCCCCGTGCGCTCCACGTCCAAC
TCGCTGGCCAAGACGGTGCCCGCGACTACGCGAACGCGCCAGGAGCCCACCATCTCGGTCAACGCCGGCGGCATG
TCGGTGGCCCCCATGCGGCCCGCCAGGAGGAGGCCCGAAGTGGCTCGACCGGCGACGGCGGGACCCTACTCGGTG
CGAGAGCATCCGGCCATGGAAGCCGCCAGCCCGGAGAGCGCCGAGTCTACGCCCAGGAGAGTCCAGGAGCCGACA
CCGAAGCGGACGACGCAGCGGCCGCGGCTGGCGGCGGTAGACACAAACGGCGCGTCGGCCTCATCGCCAAGGTCA
GCGTCCAAGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCAGGCTAGAAGCGCCACGACGGGTGCCTCTCCC
TCGGTGTCGCCCAAGGCGTACGAGGACCTGACCATGGTGGTTCCGGAGATGCCCAGCATAGCGGCGACGTTGACG
CGCAAGAAGACGGCGGATGAGCTGAAGATGCAGTCTCAGGAGGTGATGCCGGTGCGGTCTGTTCCCGAGACGGAG
GGCGAGGCTCACGAGACGCCGTCCAAGGAGATCAAGTCGCCCGTCATCGACAAGGCCGTCACGGAAGTAAAGTCC
CCCGAGGAAGAGACGCTGGCCAAGGATATCAAGCTGCCTCAGGAAGAGATCCCGGCCACAGAAATCAACAACCCA
CCCTCAAAGTCTTCGAAGACCCCTTCAAAGAAGATCCCCCCCATCCAACCCCAACCATGA
Gene >Ophun1|5233
ATGGCCGACACCAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCGCGTCACCGCCGTCAAGTCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCCCTC
CTCTTCGACGGCTTGCGCCTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAACGCCGGCTTTACCGCCCTCAAC
CACCTCGTCACCCGACTCTCGCGTCAGGAGCCCCGTCTTCTCGCAAAGGAGGCGCCCCGTACGCTGTCCGTCATC
ATCGACAGGTTCGGCGACCACAAGGACAAGTTTCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTACGTTGTC
GCTCCTGTCGACGTCGAGCGCGCCATCAGGAACCAGGCCATGGTCGGCAAGAATTCGAGAGCCAAGGAAGCGGCC
ATGCAGTGGCTTTTGCAGGTAGCGTGCCCATCTAGTCGCTCCCTTGACATGCGACAGGAGAAGACTGACGTTGAT
ACTAACGCCGCTCAGATGCATCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTCCCTCTTCTCATGGAGCTGCTC
GAGGACGCTGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGTGCGCCCTCCGTCTA
CTGGACGAGATCAGCTGCTGACGACTTTCCAGGACCGCTCCCAACGCCGCCAAGTCAGATCTCCGGCGACAACTG
AAAAACTTCAAGGTACGACCTGCCATCGAGCAGGCCATCGTCAAGACGCTCGGCCCTACCGGTCGGCCGGAAACG
CCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCCTCCCTCACGAGCGAGCGCGCAACTACCCCCGTG
ACTGAGTCTCCCGCCGAGGCCGTCGAGCCCATGTACGTCAACACGCACCGCGAGCTCGAAGACTTGTTCCGCGGC
ATGGCCGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGGATGAAGCGAGAGCAGTCGATGAGCACCCTGCGC
AAGCTCATGGCCGGAAACGCGCCAGCCGACTTCGCCGACGCCTTTCTGACCGGTCTACGCGCCATGCTGGATGGC
ATCATCAAGGCCGTCAACTCGCTGCGCACCAGTCTGTCCAAGGAAGGCTGCGGCCTCGTCCAAGACATGGCGGTG
ACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTTTTGATGCAGACGCTCGTAAAGCTCTCGGCCGGCACCAAG
AAGATAAGCTCGCAACTGGCAAACGTGACCGTCGACACCATCATCGCCCGCGTCACGTACACGGGCCGGCTGATG
CAGCACGTCTGGGGCGCCTGTCAGGACAAGAACGTGCAGCCGAGGTTGTATGCCACGGGCTGGCTCAAGACGCTA
CTCAAGAAGGAGGGTCATCACAAGAGCCACGTCGAGCATGGGGGTGGCGTCGACATGATGGAGAAGTGCATCAAG
AAGGGCCTCGGCGATGCGAATCCCGGCGTGAGGGAGAAGATGAGGTCGACCTACTGGGCCTTTTGGGCCGTGTGG
CCAGCCAAAGCCGATGCGTACGCTTCCCTTGTTTTCTTGTGAGAGAGAGCCATGGCAACTAACAGTCCTGTATAG
CATCATGGCCGACCTGGACCCGACAGCCCAGAAGCTCCTCAACAAGGATCCAAACAACCCCAACTCACCCAACAA
GGGCGCCGAAGCCGCTCGCCCCGGTCTTGGCCTGTCCAAGAGCACCATGGCGGCCGGCAAGCCCAGCGTGCGCGA
AGCCATGATGGCACAGAGGAGGGCCAACATGGCGGCCAAGAACCTGCCACCGCGTCCGGGATCGGCCATGGCGCA
CATCTCCCCCGTGCGCTCCACGTCCAACTCGCTGGCCAAGACGGTGCCCGCGACTACGCGAACGCGCCAGGAGCC
CACCATCTCGGTCAACGCCGGCGGCATGTCGGTGGCCCCCATGCGGCCCGCCAGGAGGAGGCCCGAAGTGGCTCG
ACCGGCGACGGCGGGACCCTACTCGGTGCGAGAGCATCCGGCCATGGAAGCCGCCAGCCCGGAGAGCGCCGAGTC
TACGCCCAGGAGAGTCCAGGAGCCGACACCGAAGCGGACGACGCAGCGGCCGCGGCTGGCGGCGGTAGACACAAA
CGGCGCGTCGGCCTCATCGCCAAGGTCAGCGTCCAAGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCAGGC
TAGAAGCGCCACGACGGGTGCCTCTCCCTCGGTGTCGCCCAAGGCGTACGAGGACCTGACCATGGTGGTTCCGGA
GATGCCCAGCATAGCGGCGACGTTGACGCGCAAGAAGACGGCGGATGAGCTGAAGATGCAGTCTCAGGAGGTGAT
GCCGGTGCGGTCTGTTCCCGAGACGGAGGGCGAGGCTCACGAGACGCCGTCCAAGGAGATCAAGTCGCCCGTCAT
CGACAAGGCCGTCACGGAAGTAAAGTCCCCCGAGGAAGAGACGCTGGCCAAGGATATCAAGCTGCCTCAGGAAGA
GATCCCGGCCACAGAAATCAAGTCGCCACAGACAGAGCCTCCCTCCCAGCACCCATCCCCATCGAAAGAGCAGCA
ACCCACCCTCAAAGTCTTCGAAGACCCCTTCAAAGAAGATCCCCCCCATCCAACCCCAACCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail