Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|523
Gene name
LocationContig_1159:2414..3040
Strand+
Gene length (bp)626
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01176 eIF-1a Translation initiation factor 1A / IF-1 5.2E-22 32 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BMJ3|IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus GN=Eif1ax PE=2 SV=3 1 131 5.0E-74
sp|Q5RA42|IF1AX_PONAB Eukaryotic translation initiation factor 1A, X-chromosomal OS=Pongo abelii GN=EIF1AX PE=2 SV=3 1 131 5.0E-74
sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens GN=EIF1AX PE=1 SV=2 1 131 5.0E-74
sp|Q6GVM3|IF1AY_PANTR Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Pan troglodytes GN=EIF1AY PE=2 SV=3 1 131 1.0E-73
sp|Q6VV72|IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus GN=Eif1a PE=2 SV=3 1 131 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BMJ3|IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus GN=Eif1ax PE=2 SV=3 1 131 5.0E-74
sp|Q5RA42|IF1AX_PONAB Eukaryotic translation initiation factor 1A, X-chromosomal OS=Pongo abelii GN=EIF1AX PE=2 SV=3 1 131 5.0E-74
sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens GN=EIF1AX PE=1 SV=2 1 131 5.0E-74
sp|Q6GVM3|IF1AY_PANTR Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Pan troglodytes GN=EIF1AY PE=2 SV=3 1 131 1.0E-73
sp|Q6VV72|IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus GN=Eif1a PE=2 SV=3 1 131 1.0E-73
sp|Q60872|IF1A_MOUSE Eukaryotic translation initiation factor 1A OS=Mus musculus GN=Eif1a PE=2 SV=3 1 131 1.0E-73
sp|O14602|IF1AY_HUMAN Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens GN=EIF1AY PE=1 SV=4 1 131 2.0E-73
sp|P47814|IF1A_RABIT Eukaryotic translation initiation factor 1A OS=Oryctolagus cuniculus GN=EIF1A PE=1 SV=2 1 131 2.0E-71
sp|P55877|IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif11 PE=2 SV=2 1 136 1.0E-68
sp|Q54YJ6|IF1A_DICDI Eukaryotic translation initiation factor 1A OS=Dictyostelium discoideum GN=eif1a PE=3 SV=1 1 140 3.0E-62
sp|P47815|IF1A_WHEAT Eukaryotic translation initiation factor 1A OS=Triticum aestivum PE=1 SV=2 1 140 7.0E-59
sp|P56331|IF1A_ONOVI Eukaryotic translation initiation factor 1A OS=Onobrychis viciifolia PE=2 SV=2 1 140 7.0E-58
sp|P38912|IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF11 PE=1 SV=1 18 136 5.0E-51
sp|Q8TXZ3|IF1A_METKA Translation initiation factor 1A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eIF1A PE=3 SV=1 15 113 1.0E-18
sp|C3MU29|IF1A_SULIM Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|Q97W62|IF1A_SULSO Translation initiation factor 1A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|C3N0P1|IF1A_SULIA Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.16.27) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|C4KK84|IF1A_SULIK Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|C3MK60|IF1A_SULIL Translation initiation factor 1A OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|C3NMA0|IF1A_SULIN Translation initiation factor 1A OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|C3N8M9|IF1A_SULIY Translation initiation factor 1A OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eIF1A PE=3 SV=1 24 103 3.0E-18
sp|Q974Z9|IF1A_SULTO Translation initiation factor 1A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eIF1A PE=3 SV=2 24 103 1.0E-17
sp|B0R7D8|IF1A_HALS3 Translation initiation factor 1A OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eIF1A PE=3 SV=1 23 109 4.0E-17
sp|Q9HN64|IF1A1_HALSA Translation initiation factor 1A 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eIF1A1 PE=3 SV=1 23 109 4.0E-17
sp|Q5UZM2|IF1A_HALMA Translation initiation factor 1A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif1a PE=3 SV=2 19 111 5.0E-17
sp|Q4JA54|IF1A_SULAC Translation initiation factor 1A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=eif1a PE=3 SV=1 17 103 7.0E-17
sp|O29481|IF1A_ARCFU Translation initiation factor 1A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eIF1A PE=3 SV=2 16 109 9.0E-17
sp|Q6L2G4|IF1A_PICTO Translation initiation factor 1A OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=eif1a PE=3 SV=1 29 111 1.0E-16
sp|Q3IT14|IF1A_NATPD Translation initiation factor 1A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif1a PE=3 SV=1 23 109 1.0E-16
sp|A2STQ8|IF1A_METLZ Translation initiation factor 1A OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=eIF1A PE=3 SV=1 15 109 4.0E-16
sp|Q18EX1|IF1A1_HALWD Translation initiation factor 1A 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif1a1 PE=3 SV=1 19 109 5.0E-16
sp|A4YEH8|IF1A_METS5 Translation initiation factor 1A OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=eIF1A PE=3 SV=1 30 103 6.0E-16
sp|B8D5N1|IF1A_DESK1 Translation initiation factor 1A OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=eIF1A PE=3 SV=1 13 111 3.0E-15
sp|Q979F7|IF1A_THEVO Translation initiation factor 1A OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eIF1A PE=3 SV=1 26 111 8.0E-15
sp|Q03590|IF1A_THEAC Translation initiation factor 1A OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eIF1A PE=3 SV=2 26 111 9.0E-15
sp|P57676|IF1A_AERPE Translation initiation factor 1A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eIF1A PE=3 SV=1 26 112 5.0E-14
sp|Q469J2|IF1A1_METBF Translation initiation factor 1A 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eif1a1 PE=3 SV=1 29 109 8.0E-14
sp|Q8TSA3|IF1A1_METAC Translation initiation factor 1A 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A1 PE=3 SV=1 29 109 1.0E-13
sp|Q8PUJ8|IF1A2_METMA Translation initiation factor 1A 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eIF1A2 PE=3 SV=1 10 109 1.0E-13
sp|Q2NEP1|IF1A_METST Translation initiation factor 1A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif1a PE=3 SV=1 40 109 2.0E-13
sp|Q8PVF1|IF1A1_METMA Translation initiation factor 1A 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eIF1A1 PE=3 SV=2 7 109 3.0E-13
sp|Q12YN5|IF1A_METBU Translation initiation factor 1A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=eif1a PE=3 SV=1 29 109 3.0E-13
sp|Q8TR33|IF1A2_METAC Translation initiation factor 1A 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A2 PE=3 SV=1 10 109 4.0E-13
sp|O27085|IF1A_METTH Translation initiation factor 1A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eIF1A PE=3 SV=1 40 109 8.0E-13
sp|Q8TR31|IF1A3_METAC Translation initiation factor 1A 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A3 PE=3 SV=1 5 109 1.0E-12
sp|Q18JF4|IF1A2_HALWD Translation initiation factor 1A 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif1a2 PE=3 SV=1 23 109 1.0E-12
sp|Q9HP87|IF1A2_HALSA Translation initiation factor 1A 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eIF1A2 PE=3 SV=2 23 109 6.0E-12
sp|A6UUK8|IF1A_META3 Translation initiation factor 1A OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eIF1A PE=3 SV=1 24 109 1.0E-11
sp|Q469I9|IF1A2_METBF Translation initiation factor 1A 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eif1a2 PE=3 SV=1 29 109 1.0E-11
sp|Q57887|IF1A_METJA Translation initiation factor 1A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eIF1A PE=1 SV=1 23 111 5.0E-11
sp|A4FYM5|IF1A_METM5 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eIF1A PE=3 SV=1 14 109 1.0E-10
sp|A6VJQ7|IF1A_METM7 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eIF1A PE=3 SV=1 24 109 4.0E-10
sp|A9A6C2|IF1A_METM6 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eIF1A PE=3 SV=1 24 109 4.0E-10
sp|Q6LZM1|IF1A_METMP Translation initiation factor 1A OS=Methanococcus maripaludis (strain S2 / LL) GN=eif1a PE=3 SV=1 24 109 5.0E-10
sp|Q9V138|IF1A_PYRAB Translation initiation factor 1A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eIF1A PE=1 SV=2 17 109 3.0E-09
sp|O59280|IF1A_PYRHO Translation initiation factor 1A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eIF1A PE=3 SV=2 26 109 6.0E-09
sp|Q8U0K5|IF1A_PYRFU Translation initiation factor 1A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eIF1A PE=3 SV=2 26 109 7.0E-09
sp|Q5JH78|IF1A_THEKO Translation initiation factor 1A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif1a PE=3 SV=1 15 111 3.0E-08
sp|Q8ZXV9|IF1A_PYRAE Translation initiation factor 1A OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=eIF1A PE=3 SV=2 25 107 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0003723 RNA binding Yes
GO:0006413 translational initiation Yes
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0003674 molecular_function No
GO:0008135 translation factor activity, RNA binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0045182 translation regulator activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|523
MPKNKGKGGKNRRRGTKENDDQRRELTFKEDGQEYAQVIKMLGNGRLEAMCFDGSKRLANIRGKMRKKVWINQGD
IILLSLRDFQDNKGDVILKYTADEARSLKSYGELPEHAKINETDTFGQGEDGEAYFEFVDAEDSDDSQDAAKKEV
DIDDI*
Coding >Ophun1|523
ATGCCCAAGAACAAGGGAAAGGGCGGCAAGAACCGCAGACGCGGCACAAAGGAGAATGACGACCAGCGCCGCGAA
CTCACCTTCAAGGAAGACGGTCAGGAATACGCCCAGGTGATCAAGATGCTTGGAAACGGCCGCCTGGAAGCTATG
TGCTTCGACGGCAGCAAGCGTCTCGCAAACATCCGCGGCAAGATGCGCAAGAAGGTGTGGATCAACCAAGGCGAC
ATCATCCTCCTCTCCCTCCGCGACTTCCAAGACAACAAGGGCGACGTCATCCTCAAGTATACGGCCGACGAGGCT
CGCTCACTCAAGTCGTATGGCGAGCTGCCCGAGCACGCCAAGATCAACGAAACCGACACCTTTGGCCAGGGCGAG
GATGGAGAGGCCTACTTTGAGTTTGTCGACGCCGAAGACTCGGACGACTCGCAGGATGCTGCCAAGAAGGAGGTC
GACATTGACGATATCTAA
Transcript >Ophun1|523
ATGCCCAAGAACAAGGGAAAGGGCGGCAAGAACCGCAGACGCGGCACAAAGGAGAATGACGACCAGCGCCGCGAA
CTCACCTTCAAGGAAGACGGTCAGGAATACGCCCAGGTGATCAAGATGCTTGGAAACGGCCGCCTGGAAGCTATG
TGCTTCGACGGCAGCAAGCGTCTCGCAAACATCCGCGGCAAGATGCGCAAGAAGGTGTGGATCAACCAAGGCGAC
ATCATCCTCCTCTCCCTCCGCGACTTCCAAGACAACAAGGGCGACGTCATCCTCAAGTATACGGCCGACGAGGCT
CGCTCACTCAAGTCGTATGGCGAGCTGCCCGAGCACGCCAAGATCAACGAAACCGACACCTTTGGCCAGGGCGAG
GATGGAGAGGCCTACTTTGAGTTTGTCGACGCCGAAGACTCGGACGACTCGCAGGATGCTGCCAAGAAGGAGGTC
GACATTGACGATATCTAA
Gene >Ophun1|523
ATGCCCAAGAACAAGGGAAAGGTACGCGAAAGGCGCCTATCCTCCCCCTCCTAATCCGCTATACCTCTTCTCTGC
ATTTCGTGCTGATGCCTGGGGCTACAGGGCGGCAAGAACCGCAGACGCGGCACAAAGGAGAATGACGACCAGCGC
CGCGAACTCACCTTCAAGGAAGACGGTCAGGAATACGCCCAGGTGATCAAGATGCTTGGAAACGGCCGCCTGGAA
GCTATGTGCTTCGACGGCAGCAAGCGTCTCGCAAACGTCCGTCTCTTCCCACTCATGACGCTCCCCTCACTCGAA
ACACCCATGAATCAATGCTGACGGCATCGCCACCACAGATCCGCGGCAAGATGCGCAAGAAGGTGTGGATCAACC
AAGGCGACATCATCCTCCTCTCCCTCCGCGACTTCCAAGACAACAAGGGCGACGTCATCCTCAAGTATACGGCCG
ACGAGGCTCGCTCACTCAAGTCGTATGGCGAGCTGCCCGAGCACGCCAAGATCAACGAAACCGACACCTTTGGCC
AGGGCGAGGATGGAGAGGCCTACTTTGAGTTTGTCGACGCCGAAGACTCGGACGACTCGCAGGATGCTGCCAAGA
AGGAGGTCGACATTGACGATATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail