Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5225
Gene name
LocationContig_502:2195..5172
Strand+
Gene length (bp)2977
Transcript length (bp)2712
Coding sequence length (bp)2712
Protein length (aa) 904

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 9.2E-46 522 739

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 270 292 22
2 305 327 22
3 715 737 22
4 750 772 22
5 792 814 22
6 844 866 22
7 876 898 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5225
MDSPPKSPAAGPAPLSTKTSFVGVSETESQGIGGQTRPPTPSNGSYDDVFRYRTMVSYLYSRVVASGWIPAGINE
DDCLGVMLRRSRGEYVASPDPAHPLLLGAVIRLNLAVAVTMRPQMLDGILRSLAPGQTELRFKGGSQIQIVDSLA
SVRAATVKKFQYAAICLQERLVLVWQDDLQHIIPTAMQMEERLLSLVWGEGKLPFNMLQLPSRAPSTLSSGFSSP
NGTSTPALEKGAPRLHTSESVEDLSSDPSFDRLESVARPVARTSALFIGLAMVTAISLIFGVYSGQLFTESLLDH
SYRRLGLMAFCPLLLCISLFFFQVVFTNIFQMIGPIGGVTTNSRYYSCHKPCLRRAYADGFVPPKMTIQMPVYKE
GMDSVIIPTIRSLQAAVSYYESHGGTANILINDDGLRAGISPEEAQKRRDFYHDNNIGWVARPSHNGPEGFVRKG
KFKKASNMNFALNTSQRVEAYLQDMVDARVAAGGSDLIDEADEADMYKEALSRVLEENPLAQAGGDIRVGEIILI
VDSDTRVPVNCLLYGAAEMYLSQEVAIVQHSTGVLQVSRDYFENGITYFTNLVYTSIRFSIGCGEVAPFVGHNAF
IKWQAVQDISSEDASGHTAYWSEAHVSEDFDMALRLQMKGNVIRIATYHNNEFKEGVSLTIYDEISRWKRYGFGV
SELIFHPLYLWIFRGPFTPLFYTYLGSSIMLSSKISIMAYMCSYYALGSALPLSVMNYFIVGWFRDDLASCYLTS
WNVFLSLVVVFNASSPVALAVFRYRTGERSLLGALVENAKWMPMMTVFFGGISYHIGTALLSHLLHIDMQWGATA
KEKEDSNFFQEMPRIFRTFKYMYLLIFLLVGAMIYLGVWAPPDWAITDFSVVIPLAINLTFHALSPLVLNPSLMI
FNY*
Coding >Ophun1|5225
ATGGACTCTCCGCCCAAGTCGCCGGCTGCTGGGCCTGCTCCTCTTTCTACAAAGACTTCGTTTGTTGGTGTTTCG
GAGACGGAGAGTCAGGGCATTGGTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGATGTCTTT
CGCTATCGTACTATGGTCAGCTACCTCTACAGCAGAGTCGTCGCCAGCGGATGGATCCCAGCTGGCATCAACGAA
GATGACTGTCTGGGCGTCATGCTCCGTCGCTCAAGGGGCGAATACGTAGCCTCACCCGATCCAGCCCATCCCCTT
CTCCTCGGGGCCGTCATCAGGCTGAACCTAGCCGTTGCGGTGACGATGCGTCCGCAGATGCTCGACGGGATCCTC
CGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTTGACTCGTTGGCT
TCGGTGAGGGCTGCTACGGTTAAGAAGTTTCAGTATGCGGCTATATGTCTGCAGGAGAGGCTTGTGTTGGTTTGG
CAGGATGATTTGCAGCATATCATTCCCACGGCTATGCAGATGGAGGAGAGGTTGTTGTCGCTGGTCTGGGGAGAG
GGAAAACTTCCTTTTAATATGCTTCAGCTGCCGAGCCGCGCCCCCTCGACTCTATCATCGGGCTTCTCCAGTCCG
AACGGCACGTCGACGCCGGCGCTGGAAAAGGGAGCTCCCAGGCTTCACACCAGCGAGAGTGTCGAAGATCTATCG
TCGGATCCGTCTTTCGACCGGCTTGAATCAGTGGCCCGGCCTGTAGCCCGGACGTCAGCTCTCTTCATCGGTCTC
GCCATGGTGACGGCCATTAGCCTCATCTTCGGCGTCTACTCCGGACAACTCTTCACCGAGTCTCTCCTCGACCAT
TCGTATCGACGGCTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTCAGGTTGTC
TTCACCAACATCTTCCAGATGATCGGTCCTATTGGCGGTGTCACCACCAACTCGCGATACTACTCTTGTCACAAG
CCGTGTCTTCGACGGGCTTACGCTGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCTATAAAGAG
GGCATGGACTCTGTCATCATCCCAACCATCCGAAGCTTACAGGCCGCCGTCTCATACTACGAGTCCCACGGCGGA
ACAGCAAACATCCTCATCAACGACGACGGTCTGCGAGCAGGCATCTCCCCAGAAGAAGCCCAGAAACGACGCGAC
TTCTACCACGATAACAACATCGGATGGGTGGCACGGCCCAGCCACAACGGACCAGAGGGCTTCGTCCGGAAGGGC
AAGTTCAAAAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGGGTCGAGGCTTACCTCCAGGACATG
GTCGATGCGAGGGTCGCGGCTGGGGGATCTGACTTGATTGATGAGGCGGATGAGGCGGATATGTACAAGGAGGCG
CTTTCGAGGGTGCTGGAGGAGAATCCGCTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATAATCCTCATT
GTCGACTCGGATACGCGCGTGCCCGTCAACTGTCTGCTCTACGGGGCGGCAGAAATGTATCTCAGTCAGGAGGTG
GCCATCGTCCAGCACTCAACAGGCGTCTTGCAGGTTTCACGCGATTACTTTGAAAACGGCATCACCTACTTCACC
AACCTGGTCTACACATCCATCCGCTTCTCCATCGGTTGCGGCGAGGTAGCCCCTTTTGTCGGACACAACGCCTTC
ATCAAGTGGCAAGCCGTGCAGGACATCAGCAGCGAGGATGCCAGCGGCCATACAGCCTACTGGTCTGAAGCCCAC
GTATCTGAAGACTTCGACATGGCGCTCCGGCTGCAGATGAAGGGCAACGTGATTCGCATAGCAACCTACCACAAC
AACGAGTTTAAAGAAGGCGTCTCGCTGACCATCTACGACGAAATCTCCCGCTGGAAACGTTACGGCTTCGGCGTC
AGCGAACTCATCTTCCACCCCCTCTACCTCTGGATCTTCCGCGGCCCCTTCACGCCCCTTTTCTACACCTACCTC
GGCTCCAGCATCATGCTCTCTTCCAAGATCTCCATCATGGCCTACATGTGCTCCTACTACGCTCTCGGCTCCGCC
CTTCCGCTATCAGTCATGAACTACTTCATCGTCGGCTGGTTCCGCGATGACCTGGCCTCCTGCTACCTCACCTCC
TGGAACGTCTTCCTCTCCCTCGTCGTCGTCTTCAACGCTTCCAGCCCCGTTGCCCTCGCCGTCTTCCGCTACCGG
ACAGGCGAGCGCTCGCTGCTGGGCGCCCTGGTGGAGAACGCGAAATGGATGCCCATGATGACCGTCTTCTTCGGC
GGAATCTCCTATCACATCGGCACCGCTCTTCTCTCCCACCTGCTACACATCGATATGCAATGGGGCGCGACAGCA
AAGGAAAAGGAAGACAGCAACTTCTTCCAGGAGATGCCTCGCATCTTCCGCACCTTCAAGTACATGTATCTGCTC
ATCTTCCTGCTCGTCGGTGCCATGATCTATCTCGGTGTCTGGGCGCCGCCGGACTGGGCTATTACCGACTTTTCC
GTTGTTATTCCTTTGGCTATCAACTTGACCTTTCACGCCCTTTCGCCTCTGGTCTTGAACCCGAGCTTGATGATC
TTCAACTACTGA
Transcript >Ophun1|5225
ATGGACTCTCCGCCCAAGTCGCCGGCTGCTGGGCCTGCTCCTCTTTCTACAAAGACTTCGTTTGTTGGTGTTTCG
GAGACGGAGAGTCAGGGCATTGGTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGATGTCTTT
CGCTATCGTACTATGGTCAGCTACCTCTACAGCAGAGTCGTCGCCAGCGGATGGATCCCAGCTGGCATCAACGAA
GATGACTGTCTGGGCGTCATGCTCCGTCGCTCAAGGGGCGAATACGTAGCCTCACCCGATCCAGCCCATCCCCTT
CTCCTCGGGGCCGTCATCAGGCTGAACCTAGCCGTTGCGGTGACGATGCGTCCGCAGATGCTCGACGGGATCCTC
CGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTTGACTCGTTGGCT
TCGGTGAGGGCTGCTACGGTTAAGAAGTTTCAGTATGCGGCTATATGTCTGCAGGAGAGGCTTGTGTTGGTTTGG
CAGGATGATTTGCAGCATATCATTCCCACGGCTATGCAGATGGAGGAGAGGTTGTTGTCGCTGGTCTGGGGAGAG
GGAAAACTTCCTTTTAATATGCTTCAGCTGCCGAGCCGCGCCCCCTCGACTCTATCATCGGGCTTCTCCAGTCCG
AACGGCACGTCGACGCCGGCGCTGGAAAAGGGAGCTCCCAGGCTTCACACCAGCGAGAGTGTCGAAGATCTATCG
TCGGATCCGTCTTTCGACCGGCTTGAATCAGTGGCCCGGCCTGTAGCCCGGACGTCAGCTCTCTTCATCGGTCTC
GCCATGGTGACGGCCATTAGCCTCATCTTCGGCGTCTACTCCGGACAACTCTTCACCGAGTCTCTCCTCGACCAT
TCGTATCGACGGCTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTCAGGTTGTC
TTCACCAACATCTTCCAGATGATCGGTCCTATTGGCGGTGTCACCACCAACTCGCGATACTACTCTTGTCACAAG
CCGTGTCTTCGACGGGCTTACGCTGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCTATAAAGAG
GGCATGGACTCTGTCATCATCCCAACCATCCGAAGCTTACAGGCCGCCGTCTCATACTACGAGTCCCACGGCGGA
ACAGCAAACATCCTCATCAACGACGACGGTCTGCGAGCAGGCATCTCCCCAGAAGAAGCCCAGAAACGACGCGAC
TTCTACCACGATAACAACATCGGATGGGTGGCACGGCCCAGCCACAACGGACCAGAGGGCTTCGTCCGGAAGGGC
AAGTTCAAAAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGGGTCGAGGCTTACCTCCAGGACATG
GTCGATGCGAGGGTCGCGGCTGGGGGATCTGACTTGATTGATGAGGCGGATGAGGCGGATATGTACAAGGAGGCG
CTTTCGAGGGTGCTGGAGGAGAATCCGCTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATAATCCTCATT
GTCGACTCGGATACGCGCGTGCCCGTCAACTGTCTGCTCTACGGGGCGGCAGAAATGTATCTCAGTCAGGAGGTG
GCCATCGTCCAGCACTCAACAGGCGTCTTGCAGGTTTCACGCGATTACTTTGAAAACGGCATCACCTACTTCACC
AACCTGGTCTACACATCCATCCGCTTCTCCATCGGTTGCGGCGAGGTAGCCCCTTTTGTCGGACACAACGCCTTC
ATCAAGTGGCAAGCCGTGCAGGACATCAGCAGCGAGGATGCCAGCGGCCATACAGCCTACTGGTCTGAAGCCCAC
GTATCTGAAGACTTCGACATGGCGCTCCGGCTGCAGATGAAGGGCAACGTGATTCGCATAGCAACCTACCACAAC
AACGAGTTTAAAGAAGGCGTCTCGCTGACCATCTACGACGAAATCTCCCGCTGGAAACGTTACGGCTTCGGCGTC
AGCGAACTCATCTTCCACCCCCTCTACCTCTGGATCTTCCGCGGCCCCTTCACGCCCCTTTTCTACACCTACCTC
GGCTCCAGCATCATGCTCTCTTCCAAGATCTCCATCATGGCCTACATGTGCTCCTACTACGCTCTCGGCTCCGCC
CTTCCGCTATCAGTCATGAACTACTTCATCGTCGGCTGGTTCCGCGATGACCTGGCCTCCTGCTACCTCACCTCC
TGGAACGTCTTCCTCTCCCTCGTCGTCGTCTTCAACGCTTCCAGCCCCGTTGCCCTCGCCGTCTTCCGCTACCGG
ACAGGCGAGCGCTCGCTGCTGGGCGCCCTGGTGGAGAACGCGAAATGGATGCCCATGATGACCGTCTTCTTCGGC
GGAATCTCCTATCACATCGGCACCGCTCTTCTCTCCCACCTGCTACACATCGATATGCAATGGGGCGCGACAGCA
AAGGAAAAGGAAGACAGCAACTTCTTCCAGGAGATGCCTCGCATCTTCCGCACCTTCAAGTACATGTATCTGCTC
ATCTTCCTGCTCGTCGGTGCCATGATCTATCTCGGTGTCTGGGCGCCGCCGGACTGGGCTATTACCGACTTTTCC
GTTGTTATTCCTTTGGCTATCAACTTGACCTTTCACGCCCTTTCGCCTCTGGTCTTGAACCCGAGCTTGATGATC
TTCAACTACTGA
Gene >Ophun1|5225
ATGGACTCTCCGCCCAAGTCGCCGGCTGCTGGGCCTGCTCCTCTTTCTACAAAGACTTCGTTTGTTGGTGTTTCG
GAGACGGAGAGTCAGGGCATTGGTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGATGTCTTT
CGCTATCGTACTGTGAGTCTCAGCTTCGGATTTCCCTTTTTCCTTCCCCTTGCCCCCCCCTGAAGCCTACCGTGA
TGGACTGACCGTCTTCGTCTAGATGGTCAGCTACCTCTACAGCAGAGTCGTCGCCAGCGGATGGATCCCAGCTGG
CATCAACGAAGATGACTGTCTGGGCGTCATGCTCCGTCGCTCAAGGGGCGAATACGTAGCCTCACCCGATCCAGC
CCATCCCCTTCTCCTCGGGGCCGTCATCAGGCTGAACCTAGCCGTTGCGGTGACGATGCGTCCGCAGATGCTCGA
CGGGATCCTCCGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTTGA
CTCGTTGGCTTCGGTGAGGGCTGCTACGGTTAAGAAGTTTCAGTATGCGGCTATATGTCTGCAGGAGAGGCTTGT
GTTGGTTTGGCAGGATGATTTGCAGCATATCATTCCCACGGCTATGCAGATGGAGGAGAGGTTGTTGTCGCTGGT
GAGCCCCTGATTTCGTTGTCTCGTCTTCTTCTGAACCTTGGAGCTGATGGTGGAGAATCACAGGTCTGGGGAGAG
GGAAAACTTCCTTTTAATATGCTTCAGCTGCCGAGCCGCGCCCCCTCGACTCTATCATCGGGCTTCTCCAGTCCG
AACGGCACGTCGACGCCGGCGCTGGAAAAGGGAGCTCCCAGGCTTCACACCAGCGAGAGTGTCGAAGATCTATCG
TCGGATCCGTCTTTCGACCGGCTTGAATCAGTGGCCCGGCCTGTAGCCCGGACGTCAGCTCTCTTCATCGGTCTC
GCCATGGTGACGGCCATTAGCCTCATCTTCGGCGTCTACTCCGGACAACTCTTCACCGAGTCTCTCCTCGACCAT
TCGTATCGACGGCTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTCAGGTTGTC
TTCACCAACATCTTCCAGATGATCGGTCCTATTGGCGGTGTCACCACCAACTCGCGATACTACTCTTGTCACAAG
CCGTGTCTTCGACGGGCTTACGCTGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCTATAAAGAG
GGCATGGACTCTGTCATCATCCCAACCATCCGAAGCTTACAGGCCGCCGTCTCATACTACGAGTCCCACGGCGGA
ACAGCAAACATCCTCATCAACGACGACGGTCTGCGAGCAGGCATCTCCCCAGAAGAAGCCCAGAAACGACGCGAC
TTCTACCACGATAACAACATCGGATGGGTGGCACGGCCCAGCCACAACGGACCAGAGGGCTTCGTCCGGAAGGGC
AAGTTCAAAAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGGGTCGAGGCTTACCTCCAGGACATG
GTCGATGCGAGGGTCGCGGCTGGGGGATCTGACTTGATTGATGAGGCGGATGAGGCGGATATGTACAAGGAGGCG
CTTTCGAGGGTGCTGGAGGAGAATCCGCTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATAATCCTCATT
GTCGACTCGGATACGCGCGTGGTAAGCAGGCTCTCTCTTTGAATCCGTTCTGATACTGACCATGATACAGCCCGT
CAACTGTCTGCTCTACGGGGCGGCAGAAATGTATCTCAGTCAGGAGGTGGCCATCGTCCAGCACTCAACAGGCGT
CTTGCAGGTTTCACGCGATTACTTTGAAAACGGCATCACCTACTTCACCAACCTGGTCTACACATCCATCCGCTT
CTCCATCGGTTGCGGCGAGGTAGCCCCTTTTGTCGGACACAACGCCTTCATCAAGTGGCAAGGTAAACAACCGAA
CCACCATATCCCTACCCCTGAATCTCACAAGCTGATGACATGTACGAACACAGCCGTGCAGGACATCAGCAGCGA
GGATGCCAGCGGCCATACAGCCTACTGGTCTGAAGCCCACGTATCTGAAGACTTCGACATGGCGCTCCGGCTGCA
GATGAAGGGCAACGTGATTCGCATAGCAACCTACCACAACAACGAGTTTAAAGAAGGCGTCTCGCTGACCATCTA
CGACGAAATCTCCCGCTGGAAACGTTACGGCTTCGGCGTCAGCGAACTCATCTTCCACCCCCTCTACCTCTGGAT
CTTCCGCGGCCCCTTCACGCCCCTTTTCTACACCTACCTCGGCTCCAGCATCATGCTCTCTTCCAAGATCTCCAT
CATGGCCTACATGTGCTCCTACTACGCTCTCGGCTCCGCCCTTCCGCTATCAGTCATGAACTACTTCATCGTCGG
CTGGTTCCGCGATGACCTGGCCTCCTGCTACCTCACCTCCTGGAACGTCTTCCTCTCCCTCGTCGTCGTCTTCAA
CGCTTCCAGCCCCGTTGCCCTCGCCGTCTTCCGCTACCGGACAGGCGAGCGCTCGCTGCTGGGCGCCCTGGTGGA
GAACGCGAAATGGATGCCCATGATGACCGTCTTCTTCGGCGGAATCTCCTATCACATCGGCACCGCTCTTCTCTC
CCACCTGCTACACATCGATATGCAATGGGGCGCGACAGCAAAGGAAAAGGAAGACAGCAACTTCTTCCAGGAGAT
GCCTCGCATCTTCCGCACCTTCAAGTACATGTATCTGCTCATCTTCCTGCTCGTCGGTGCCATGATCTATCTCGG
TGTCTGGGCGCCGCCGGACTGGGCTATTACCGACTTTTCCGTTGTTATTCCTTTGGCTATCAACTTGACCTTTCA
CGCCCTTTCGCCTCTGGTCTTGAACCCGAGCTTGATGATCTTCAACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail