Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5218
Gene name
LocationContig_500:11638..13908
Strand-
Gene length (bp)2270
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02940 mRNA_triPase mRNA capping enzyme, beta chain 4.4E-58 429 673

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Q6|CET1_SCHPO mRNA-capping enzyme subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pct1 PE=1 SV=1 460 710 5.0E-25
sp|O93803|CET1_CANAL mRNA-capping enzyme subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CET1 PE=3 SV=2 419 707 2.0E-18
sp|Q5KEQ1|CET1_CRYNJ mRNA-capping enzyme subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CET1 PE=3 SV=1 411 710 4.0E-17
sp|Q6BND2|CET1_DEBHA mRNA-capping enzyme subunit beta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CET1 PE=3 SV=2 419 711 2.0E-10

GO

GO Term Description Terminal node
GO:0004651 polynucleotide 5'-phosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0098518 polynucleotide phosphatase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5218
MPFHDARSAPSPYRPTPASAVSMAFPFSPAQSSADVKSPGQRHQYPPGPYQHHHLQQQPPQPHPHPPLVPPSLPQ
QATQRPQHHPPPVFAHQQSPQQQQYLHHHQHQRSLSTHSSASASASASAPTPTPTSAHPSGLSLPGSSPATASRP
SPDFGRQHQPSVAAPSSAWSAAGSFARPASPPQPPRTAQQSTTPDSHYPQSLVAAAGQRVSSAHGQHDSSPVSDV
PGRPISRPDREHSVSVSPHTRVASLSSNPPSELERKSSRIVMTTDGAVTPAKRKLQDRSLSPHELEHQREPRQPP
AETNGGHKSVSPAIAPRKRRVYGAQPIWAQSGRNVGIKTLKNGNFVLQKRVHSHLNGAKTDLSPATTATTAAAAA
ASGRDNRPPAAPSPGTPRTQPAPAPAPQGAAADAGPQNPLGPWEASITGVKPYEEISKTVADFVFINVVNHPDFQ
EIASRGIQFEIEAKLGTLIDKDTNCRVDRLLDTESILHDTGRVAFRSSMTEAHHKAFNEFLNQVVIQTDPRAPGG
NSRVQVLYKHRREVDRFFDLPANQLGQVPGCMRSRVGARGRNVRVRVTYDQKTREVLNRIIKARVADLDLHMPSC
PMDCRLSINLEMAWDGPAEELEQPGPGHADRNKDRLSYTQGHYQIDLTQVTQTTTGPGNTQRLEKEHELEIELAA
GIVVDQGTKALSGAPQRYQELIEGLVDNIRVLARKAREFSR*
Coding >Ophun1|5218
ATGCCCTTTCACGACGCGCGCTCGGCTCCATCGCCATACCGCCCGACGCCCGCCAGCGCCGTCTCCATGGCCTTT
CCCTTCTCGCCGGCGCAGTCTTCTGCCGACGTCAAGAGCCCCGGCCAGCGCCATCAGTATCCACCTGGACCCTAC
CAGCACCACCACCTTCAGCAGCAGCCGCCACAACCTCACCCTCACCCTCCTCTAGTACCGCCCTCTCTCCCGCAA
CAGGCGACGCAGCGGCCCCAGCATCATCCGCCGCCCGTCTTTGCTCATCAGCAATCGCCACAACAGCAGCAGTAC
CTCCACCACCACCAACACCAACGCTCCCTCTCCACCCACTCCTCCGCTTCCGCTTCCGCCTCCGCCTCCGCGCCG
ACGCCGACGCCGACCTCGGCCCATCCCTCGGGCCTTTCCCTCCCAGGCAGTAGCCCTGCGACTGCCTCGCGGCCC
TCGCCTGACTTTGGTCGTCAGCATCAACCGTCCGTTGCTGCGCCGTCCTCGGCCTGGTCTGCGGCCGGCTCCTTT
GCCCGCCCCGCGAGCCCTCCTCAGCCGCCGAGAACGGCACAACAATCGACGACACCTGACAGCCACTACCCGCAG
TCACTGGTGGCCGCCGCCGGCCAGCGAGTATCGAGCGCCCACGGCCAGCACGATTCCTCGCCAGTCTCAGACGTC
CCCGGGCGTCCGATATCCCGCCCCGACCGAGAGCACAGCGTGTCCGTCAGTCCCCACACGCGTGTGGCGTCGCTG
TCGAGCAATCCGCCGTCGGAGCTGGAGCGAAAGTCCAGCCGCATCGTCATGACTACCGACGGTGCCGTCACCCCG
GCTAAGCGAAAGCTCCAAGACCGCAGTCTGAGCCCGCACGAGCTCGAGCACCAGCGAGAACCGCGACAGCCGCCT
GCCGAGACCAACGGCGGCCACAAGTCGGTATCGCCCGCCATCGCGCCCAGGAAGAGACGTGTCTATGGTGCCCAG
CCTATATGGGCCCAAAGCGGCCGCAACGTGGGCATCAAGACGCTAAAGAATGGAAATTTTGTCCTACAGAAGCGG
GTACATTCCCATCTCAACGGCGCAAAGACCGACTTATCCCCGGCCACCACCGCCACCACCGCCGCTGCCGCCGCC
GCCTCCGGCCGCGACAACCGGCCGCCCGCCGCTCCGTCGCCTGGCACGCCTCGGACCCAACCGGCCCCCGCACCG
GCCCCGCAAGGCGCCGCGGCGGACGCAGGCCCGCAGAACCCTTTGGGCCCTTGGGAGGCCAGCATCACGGGCGTC
AAGCCGTACGAGGAGATATCCAAGACGGTGGCCGACTTTGTTTTCATAAACGTTGTCAACCATCCCGACTTTCAG
GAAATCGCCAGTCGCGGCATCCAGTTTGAGATTGAGGCCAAATTGGGGACCCTCATCGACAAGGATACTAATTGT
CGAGTCGACAGGCTGCTCGACACGGAGAGTATCCTTCACGATACGGGGCGCGTTGCCTTTCGGAGTAGCATGACG
GAGGCTCACCACAAGGCTTTCAACGAATTCCTCAATCAGGTCGTCATTCAGACCGACCCTCGGGCACCAGGAGGC
AACAGCAGAGTACAGGTGCTGTACAAACACCGGCGTGAAGTGGACCGCTTCTTCGATCTTCCGGCCAACCAGCTG
GGGCAAGTTCCGGGCTGCATGCGTTCGCGGGTCGGGGCGCGCGGGCGAAACGTTCGTGTGCGAGTGACGTACGAC
CAGAAGACGCGCGAGGTGCTCAACAGGATCATCAAGGCGCGAGTAGCGGACCTCGATCTTCACATGCCATCGTGT
CCTATGGACTGCCGGCTGAGCATCAACCTCGAGATGGCCTGGGATGGCCCGGCCGAGGAGCTAGAGCAACCAGGG
CCCGGCCACGCCGATCGAAACAAAGACCGGTTAAGCTACACGCAGGGGCATTATCAGATTGATCTGACGCAGGTG
ACGCAGACGACGACAGGTCCAGGGAACACGCAGCGGTTGGAAAAAGAGCACGAGCTCGAAATCGAACTGGCGGCT
GGAATCGTCGTCGACCAAGGCACCAAGGCGTTGAGCGGCGCGCCGCAGCGATACCAGGAGCTCATCGAGGGCCTC
GTGGACAACATTCGGGTGCTGGCGCGCAAGGCGAGGGAGTTTTCGCGCTAA
Transcript >Ophun1|5218
ATGCCCTTTCACGACGCGCGCTCGGCTCCATCGCCATACCGCCCGACGCCCGCCAGCGCCGTCTCCATGGCCTTT
CCCTTCTCGCCGGCGCAGTCTTCTGCCGACGTCAAGAGCCCCGGCCAGCGCCATCAGTATCCACCTGGACCCTAC
CAGCACCACCACCTTCAGCAGCAGCCGCCACAACCTCACCCTCACCCTCCTCTAGTACCGCCCTCTCTCCCGCAA
CAGGCGACGCAGCGGCCCCAGCATCATCCGCCGCCCGTCTTTGCTCATCAGCAATCGCCACAACAGCAGCAGTAC
CTCCACCACCACCAACACCAACGCTCCCTCTCCACCCACTCCTCCGCTTCCGCTTCCGCCTCCGCCTCCGCGCCG
ACGCCGACGCCGACCTCGGCCCATCCCTCGGGCCTTTCCCTCCCAGGCAGTAGCCCTGCGACTGCCTCGCGGCCC
TCGCCTGACTTTGGTCGTCAGCATCAACCGTCCGTTGCTGCGCCGTCCTCGGCCTGGTCTGCGGCCGGCTCCTTT
GCCCGCCCCGCGAGCCCTCCTCAGCCGCCGAGAACGGCACAACAATCGACGACACCTGACAGCCACTACCCGCAG
TCACTGGTGGCCGCCGCCGGCCAGCGAGTATCGAGCGCCCACGGCCAGCACGATTCCTCGCCAGTCTCAGACGTC
CCCGGGCGTCCGATATCCCGCCCCGACCGAGAGCACAGCGTGTCCGTCAGTCCCCACACGCGTGTGGCGTCGCTG
TCGAGCAATCCGCCGTCGGAGCTGGAGCGAAAGTCCAGCCGCATCGTCATGACTACCGACGGTGCCGTCACCCCG
GCTAAGCGAAAGCTCCAAGACCGCAGTCTGAGCCCGCACGAGCTCGAGCACCAGCGAGAACCGCGACAGCCGCCT
GCCGAGACCAACGGCGGCCACAAGTCGGTATCGCCCGCCATCGCGCCCAGGAAGAGACGTGTCTATGGTGCCCAG
CCTATATGGGCCCAAAGCGGCCGCAACGTGGGCATCAAGACGCTAAAGAATGGAAATTTTGTCCTACAGAAGCGG
GTACATTCCCATCTCAACGGCGCAAAGACCGACTTATCCCCGGCCACCACCGCCACCACCGCCGCTGCCGCCGCC
GCCTCCGGCCGCGACAACCGGCCGCCCGCCGCTCCGTCGCCTGGCACGCCTCGGACCCAACCGGCCCCCGCACCG
GCCCCGCAAGGCGCCGCGGCGGACGCAGGCCCGCAGAACCCTTTGGGCCCTTGGGAGGCCAGCATCACGGGCGTC
AAGCCGTACGAGGAGATATCCAAGACGGTGGCCGACTTTGTTTTCATAAACGTTGTCAACCATCCCGACTTTCAG
GAAATCGCCAGTCGCGGCATCCAGTTTGAGATTGAGGCCAAATTGGGGACCCTCATCGACAAGGATACTAATTGT
CGAGTCGACAGGCTGCTCGACACGGAGAGTATCCTTCACGATACGGGGCGCGTTGCCTTTCGGAGTAGCATGACG
GAGGCTCACCACAAGGCTTTCAACGAATTCCTCAATCAGGTCGTCATTCAGACCGACCCTCGGGCACCAGGAGGC
AACAGCAGAGTACAGGTGCTGTACAAACACCGGCGTGAAGTGGACCGCTTCTTCGATCTTCCGGCCAACCAGCTG
GGGCAAGTTCCGGGCTGCATGCGTTCGCGGGTCGGGGCGCGCGGGCGAAACGTTCGTGTGCGAGTGACGTACGAC
CAGAAGACGCGCGAGGTGCTCAACAGGATCATCAAGGCGCGAGTAGCGGACCTCGATCTTCACATGCCATCGTGT
CCTATGGACTGCCGGCTGAGCATCAACCTCGAGATGGCCTGGGATGGCCCGGCCGAGGAGCTAGAGCAACCAGGG
CCCGGCCACGCCGATCGAAACAAAGACCGGTTAAGCTACACGCAGGGGCATTATCAGATTGATCTGACGCAGGTG
ACGCAGACGACGACAGGTCCAGGGAACACGCAGCGGTTGGAAAAAGAGCACGAGCTCGAAATCGAACTGGCGGCT
GGAATCGTCGTCGACCAAGGCACCAAGGCGTTGAGCGGCGCGCCGCAGCGATACCAGGAGCTCATCGAGGGCCTC
GTGGACAACATTCGGGTGCTGGCGCGCAAGGCGAGGGAGTTTTCGCGCTAA
Gene >Ophun1|5218
ATGCCCTTTCACGACGCGCGCTCGGCTCCATCGCCATACCGCCCGACGCCCGCCAGCGCCGTCTCCATGGCCTTT
CCCTTCTCGCCGGCGCAGTCTTCTGCCGACGTCAAGAGCCCCGGCCAGCGCCATCAGTATCCACCTGGACCCTAC
CAGCACCACCACCTTCAGCAGCAGCCGCCACAACCTCACCCTCACCCTCCTCTAGTACCGCCCTCTCTCCCGCAA
CAGGCGACGCAGCGGCCCCAGCATCATCCGCCGCCCGTCTTTGCTCATCAGCAATCGCCACAACAGCAGCAGTAC
CTCCACCACCACCAACACCAACGCTCCCTCTCCACCCACTCCTCCGCTTCCGCTTCCGCCTCCGCCTCCGCGCCG
ACGCCGACGCCGACCTCGGCCCATCCCTCGGGCCTTTCCCTCCCAGGCAGTAGCCCTGCGACTGCCTCGCGGCCC
TCGCCTGACTTTGGTCGTCAGCATCAACCGTCCGTTGCTGCGCCGTCCTCGGCCTGGTCTGCGGCCGGCTCCTTT
GCCCGCCCCGCGAGCCCTCCTCAGCCGCCGAGAACGGCACAACAATCGACGACACCTGACAGCCACTACCCGCAG
TCACTGGTGGCCGCCGCCGGCCAGCGAGTATCGAGCGCCCACGGCCAGCACGATTCCTCGCCAGTCTCAGACGTC
CCCGGGCGTCCGATATCCCGCCCCGACCGAGAGCACAGCGTGTCCGTCAGTCCCCACACGCGTGTGGCGTCGCTG
TCGAGCAATCCGCCGTCGGAGCTGGAGCGAAAGTCCAGCCGCATCGTCATGACTACCGACGGTGCCGTCACCCCG
GCTAAGCGAAAGCTCCAAGACCGCAGTCTGAGCCCGCACGAGCTCGAGCACCAGCGAGAACCGCGACAGCCGCCT
GCCGAGACCAACGGCGGCCACAAGTCGGTATCGCCCGCCATCGCGCCCAGGAAGAGACGTGTCTATGGTGCCCAG
CCTATATGGGCCCAAAGCGGCCGCAACGTGGGCATCAAGACGCTAAAGAATGGAAATTTTGTCCTACAGAAGCGG
GTACATTCCCATCTCAACGGCGCAAAGACCGACTTATCCCCGGCCACCACCGCCACCACCGCCGCTGCCGCCGCC
GCCTCCGGCCGCGACAACCGGCCGCCCGCCGCTCCGTCGCCTGGCACGCCTCGGACCCAACCGGCCCCCGCACCG
GCCCCGCAAGGCGCCGCGGCGGACGCAGGCCCGCAGAACCCTTTGGGCCCTTGGGAGGCCAGCATCACGGGCGTC
AAGCCGTACGAGGAGATATCCAAGACGGTGGCCGACTTTGTTTTCATAAACGTTGTCAACCATCCCGACTTTCAG
GAAATCGCCAGTCGCGGCATCCAGTTTGAGATTGAGGCCAAATTGGGGACCCTCATCGACAAGGATACTAATTGT
CGAGTCGACAGGCTGCTCGACACGGAGAGTATCCTTCACGATACGGGGCGCGTTGCCTTTCGGAGTAGCATGACG
GAGGTCAGTCTGCCCCTCGTCCCCATCGTCTCGTGTACACAAGACTAACACCTCGTCAGGCTCACCACAAGGCTT
TCAACGAATTCCTCAATCAGGTCGTCATTCAGACCGACCCTCGGGCACCAGGAGGCAACAGCAGAGTACAGGTGC
TGTACAAACACCGGCGTGAAGTGGACCGCTTCTTCGATCTTCCGGCCAACCAGCTGGGGCAAGTTCCGGGCTGCA
TGCGTTCGCGGGTCGGGGCGCGCGGGCGAAACGTTCGTGTGCGAGTGACGTACGACCAGAAGACGCGCGAGGTGC
TCAACAGGATCATCAAGGCGCGAGTAGCGGACCTCGATCTTCACATGCCATCGTGTCCTATGGACTGCCGGCTGA
GCATCAACCTCGAGATGGCCTGGGATGGCCCGGCCGAGGAGCTAGAGCAACCAGGGCCCGGCCACGCCGATCGAA
ACAAAGACCGGTTAAGCTACACGCAGGGGCATTATCAGATTGATCTGACGCAGGTGACGCAGACGACGACAGGTC
CAGGGGTGAGTTTCCCATGGCCTCTGCCCCTTATGACTATGTTCAAGCAACTGACGGCACAGGGACAGAACACGC
AGCGGTTGGAAAAAGAGCACGAGCTCGAAATCGAACTGGCGGCTGGAATCGTCGTCGACCAAGGCACCAAGGCGT
TGAGCGGCGCGCCGCAGCGATACCAGGAGCTCATCGAGGGCCTCGTGGACAACATTCGGGTGCTGGCGCGCAAGG
CGAGGGAGTTTTCGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail