Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5203
Gene name
LocationContig_50:27865..28935
Strand-
Gene length (bp)1070
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 1.8E-69 12 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5VKE8|SDHL_YEAS6 L-serine dehydratase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDL1 PE=3 SV=1 31 320 7.0E-63
sp|C8ZAU6|SDHL_YEAS8 L-serine dehydratase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDL1 PE=3 SV=1 31 320 7.0E-61
sp|B3LU13|SDHL_YEAS1 L-serine dehydratase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDL1 PE=3 SV=1 31 320 7.0E-61
sp|A6ZVB1|SDHL_YEAS7 L-serine dehydratase OS=Saccharomyces cerevisiae (strain YJM789) GN=SDL1 PE=3 SV=1 31 320 1.0E-60
sp|P25379|STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA1 PE=1 SV=2 12 326 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5VKE8|SDHL_YEAS6 L-serine dehydratase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDL1 PE=3 SV=1 31 320 7.0E-63
sp|C8ZAU6|SDHL_YEAS8 L-serine dehydratase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDL1 PE=3 SV=1 31 320 7.0E-61
sp|B3LU13|SDHL_YEAS1 L-serine dehydratase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDL1 PE=3 SV=1 31 320 7.0E-61
sp|A6ZVB1|SDHL_YEAS7 L-serine dehydratase OS=Saccharomyces cerevisiae (strain YJM789) GN=SDL1 PE=3 SV=1 31 320 1.0E-60
sp|P25379|STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA1 PE=1 SV=2 12 326 2.0E-60
sp|P0CF23|SDH1_YEASX L-serine dehydratase OS=Saccharomyces cerevisiae GN=SDL1 PE=3 SV=1 31 320 2.0E-60
sp|Q8VBT2|SDHL_MOUSE L-serine dehydratase/L-threonine deaminase OS=Mus musculus GN=Sds PE=1 SV=3 14 332 1.0E-59
sp|P20132|SDHL_HUMAN L-serine dehydratase/L-threonine deaminase OS=Homo sapiens GN=SDS PE=1 SV=2 11 332 1.0E-57
sp|Q0VCW4|SDHL_BOVIN L-serine dehydratase/L-threonine deaminase OS=Bos taurus GN=SDS PE=2 SV=1 11 332 4.0E-56
sp|P09367|SDHL_RAT L-serine dehydratase/L-threonine deaminase OS=Rattus norvegicus GN=Sds PE=1 SV=3 14 332 1.0E-54
sp|Q8R238|SDSL_MOUSE Serine dehydratase-like OS=Mus musculus GN=Sdsl PE=1 SV=1 11 332 4.0E-54
sp|Q96GA7|SDSL_HUMAN Serine dehydratase-like OS=Homo sapiens GN=SDSL PE=1 SV=1 2 334 2.0E-48
sp|Q86B06|SDHL_DICDI L-serine dehydratase OS=Dictyostelium discoideum GN=sds PE=3 SV=1 4 321 4.0E-46
sp|P0CF22|YI167_YEAST Putative truncated L-serine dehydratase SDL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDL1 PE=5 SV=1 138 320 4.0E-36
sp|Q9ZSS6|THD1_ARATH Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana GN=OMR1 PE=1 SV=1 14 276 3.0E-21
sp|P25306|THD1_SOLLC Threonine dehydratase biosynthetic, chloroplastic OS=Solanum lycopersicum GN=TD PE=1 SV=1 14 278 3.0E-18
sp|O94634|THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1677.03c PE=3 SV=1 14 288 3.0E-17
sp|P0CF21|YI168_YEAST Putative truncated L-serine dehydratase YIL168W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL168W PE=5 SV=1 31 129 9.0E-17
sp|Q10725|FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii GN=psdht PE=1 SV=3 15 315 3.0E-16
sp|O42615|THDH_BLAAD Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans GN=ILV1 PE=3 SV=1 13 288 1.0E-15
sp|Q2PGG3|SRR_ARATH Serine racemase OS=Arabidopsis thaliana GN=SR PE=1 SV=1 13 235 2.0E-15
sp|Q02145|ILVA_LACLA L-threonine dehydratase biosynthetic IlvA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvA PE=3 SV=3 14 318 2.0E-15
sp|Q39469|THD1_CICAR Threonine dehydratase biosynthetic, chloroplastic OS=Cicer arietinum PE=2 SV=1 14 287 9.0E-15
sp|Q9GZT4|SRR_HUMAN Serine racemase OS=Homo sapiens GN=SRR PE=1 SV=1 13 317 2.0E-14
sp|A0JNI4|SRR_BOVIN Serine racemase OS=Bos taurus GN=SRR PE=2 SV=1 13 317 3.0E-14
sp|P53607|ILVA_BURM1 L-threonine dehydratase biosynthetic IlvA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvA PE=3 SV=1 31 321 1.0E-13
sp|Q74FW6|TSAL_GEOSL L-threonine ammonia-lyase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tdcB PE=1 SV=1 14 316 1.0E-13
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2 23 288 2.0E-13
sp|Q9CKJ2|ILVA_PASMU L-threonine dehydratase biosynthetic IlvA OS=Pasteurella multocida (strain Pm70) GN=ilvA PE=3 SV=1 15 288 2.0E-13
sp|Q8CNK9|ILVA_STAES L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvA PE=3 SV=2 14 237 5.0E-13
sp|Q5HMF5|ILVA_STAEQ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvA PE=3 SV=1 14 237 5.0E-13
sp|O59791|SRR_SCHPO Serine racemase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SRR PE=1 SV=1 13 317 8.0E-13
sp|P04968|ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) GN=ilvA PE=1 SV=1 15 288 1.0E-12
sp|P20506|ILVA_SALTY L-Threonine dehydratase biosynthetic IlvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvA PE=3 SV=3 15 288 1.0E-12
sp|P36007|SRY1_YEAST Threo-3-hydroxyaspartate ammonia-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRY1 PE=1 SV=1 13 317 1.0E-11
sp|A2XWA9|SRR_ORYSI Serine racemase OS=Oryza sativa subsp. indica GN=OsI_16936 PE=3 SV=1 13 329 1.0E-11
sp|P46493|ILVA_HAEIN L-threonine dehydratase biosynthetic IlvA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvA PE=3 SV=1 3 317 1.0E-11
sp|Q7XSN8|SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica GN=SERR PE=1 SV=2 13 329 1.0E-11
sp|P55664|Y4TJ_RHISN Putative threonine dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a01490 PE=3 SV=1 14 323 2.0E-11
sp|P37946|ILVA_BACSU L-threonine dehydratase biosynthetic IlvA OS=Bacillus subtilis (strain 168) GN=ilvA PE=3 SV=1 14 318 7.0E-11
sp|Q54HH2|SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum GN=srr PE=3 SV=1 13 182 1.0E-10
sp|Q7A5L8|TDCB_STAAN L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain N315) GN=tdcB PE=1 SV=1 14 317 2.0E-09
sp|Q99U50|TDCB_STAAM L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tdcB PE=3 SV=1 14 317 2.0E-09
sp|Q2YY67|TDCB_STAAB L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tdcB PE=3 SV=2 14 155 2.0E-09
sp|Q6GGX0|TDCB_STAAR L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MRSA252) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q99SJ1|ILVA_STAAM L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvA PE=3 SV=1 14 318 3.0E-09
sp|Q7A4H2|ILVA_STAAN L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain N315) GN=ilvA PE=3 SV=1 14 318 3.0E-09
sp|Q3V7T5|ILVA_STAAR L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MRSA252) GN=ilvA PE=3 SV=1 14 265 3.0E-09
sp|Q2FH01|TDCB_STAA3 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain USA300) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q2FYJ3|TDCB_STAA8 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain NCTC 8325) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q5HFY5|TDCB_STAAC L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain COL) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q6G9C4|TDCB_STAAS L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MSSA476) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q8NWQ4|TDCB_STAAW L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MW2) GN=tdcB PE=3 SV=1 14 155 3.0E-09
sp|Q2FWJ9|ILVA_STAA8 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvA PE=3 SV=1 14 265 5.0E-09
sp|Q3V7T4|ILVA_STAAS L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MSSA476) GN=ilvA PE=3 SV=1 14 265 5.0E-09
sp|Q8NVI8|ILVA_STAAW L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MW2) GN=ilvA PE=3 SV=1 14 265 5.0E-09
sp|Q2FF63|ILVA_STAA3 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain USA300) GN=ilvA PE=3 SV=1 14 265 5.0E-09
sp|Q5HEE0|ILVA_STAAC L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain COL) GN=ilvA PE=3 SV=1 14 265 5.0E-09
sp|Q49Z16|ILVA_STAS1 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvA PE=3 SV=1 14 237 9.0E-09
sp|Q2YUE8|ILVA_STAAB L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvA PE=3 SV=1 14 265 1.0E-08
sp|Q8TQD4|THRC_METAC Threonine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thrC PE=1 SV=1 10 224 2.0E-08
sp|Q9QZX7|SRR_MOUSE Serine racemase OS=Mus musculus GN=Srr PE=1 SV=1 13 317 3.0E-08
sp|Q76EQ0|SRR_RAT Serine racemase OS=Rattus norvegicus GN=Srr PE=1 SV=1 13 317 4.0E-08
sp|P45837|THRC_MYCLE Threonine synthase OS=Mycobacterium leprae (strain TN) GN=thrC PE=3 SV=1 15 288 7.0E-08
sp|A0R220|THRC_MYCS2 Threonine synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=thrC PE=1 SV=1 15 288 8.0E-08
sp|Q9KC63|ILVA_BACHD L-threonine dehydratase biosynthetic IlvA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvA PE=3 SV=1 14 247 1.0E-07
sp|Q4L7U4|ILVA_STAHJ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvA PE=3 SV=1 14 162 2.0E-07
sp|P9WG59|THRC_MYCTU Threonine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thrC PE=1 SV=1 15 319 3.0E-07
sp|P9WG58|THRC_MYCTO Threonine synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thrC PE=3 SV=1 15 319 3.0E-07
sp|P66903|THRC_MYCBO Threonine synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thrC PE=3 SV=1 15 319 3.0E-07
sp|P09123|THRC_BACSL Threonine synthase OS=Bacillus sp. (strain ULM1) GN=thrC PE=3 SV=1 14 319 7.0E-07
sp|Q9X7F1|ILVA_MYCLE L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium leprae (strain TN) GN=ilvA PE=3 SV=1 15 168 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3675
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|535
Ophiocordyceps australis map64 (Brazil) OphauB2|3390
Ophiocordyceps camponoti-floridani Ophcf2|04889
Ophiocordyceps camponoti-rufipedis Ophun1|5203 (this protein)
Ophiocordyceps kimflemingae Ophio5|2530
Ophiocordyceps subramaniannii Hirsu2|7104

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5203
MGSLGSEAKLPWHQTPCVLSPQLSRLAGCNIYLKLDNLQPSGSFKSRGIGNLMTRAAATATGPVHFYCSSGGNAG
LACATSAVALRRPATIVVPVTTSEMMKSKLLDLGVQVYQVGKNLAAADDYLRNELLANDPDGVYVPPYDHPHVWD
GAASIVGELREQLEVPIDAIVCSVGGGGLFNGLMQGIEAFPWSGSKPDVVCVETAGADSLNASVRAGTHVTLPEI
TSIATSLGCSRVSTESWRWIQRPNTHSLVVSDADAALSCVRFADDARHLVEVSCGAALAAVYRGDLRRCLGRGVS
EGEWAEKNIVVVICGGSGVTLGILDQYRREYGSLASIKA*
Coding >Ophun1|5203
ATGGGCTCCCTCGGATCCGAAGCGAAGCTCCCCTGGCACCAGACGCCATGCGTCCTCAGCCCCCAGCTATCGCGC
CTCGCCGGCTGCAACATCTATCTCAAGCTCGACAATCTTCAGCCCAGCGGTTCCTTCAAGTCCCGCGGTATCGGT
AACTTGATGACGCGCGCTGCCGCCACAGCAACCGGCCCTGTCCACTTCTACTGCTCGTCCGGCGGCAACGCGGGT
CTCGCATGCGCAACATCGGCCGTTGCATTACGCCGACCCGCCACCATTGTCGTGCCCGTCACGACATCAGAAATG
ATGAAGTCCAAGCTGCTCGACCTCGGCGTCCAAGTCTATCAAGTGGGCAAGAACCTGGCGGCGGCAGACGACTAC
CTGCGTAACGAGCTCCTGGCCAACGACCCAGACGGCGTCTACGTGCCCCCTTACGACCACCCTCACGTATGGGAC
GGAGCAGCATCCATCGTGGGCGAGCTACGAGAGCAGCTCGAAGTGCCCATCGACGCCATCGTCTGCAGCGTCGGC
GGCGGCGGCCTCTTCAACGGCCTCATGCAAGGCATCGAAGCCTTCCCCTGGTCCGGCAGCAAGCCCGACGTCGTA
TGCGTCGAGACAGCCGGCGCAGATAGTCTCAACGCATCGGTCCGAGCAGGCACCCACGTGACGCTCCCAGAGATA
ACCTCCATCGCCACCTCCCTCGGCTGCTCGCGCGTCTCCACCGAATCATGGCGCTGGATCCAACGACCCAACACG
CACAGCCTCGTCGTCTCAGACGCCGACGCCGCCCTCAGCTGCGTCCGATTCGCAGACGACGCCCGCCATCTGGTC
GAGGTATCGTGCGGTGCCGCGCTGGCAGCTGTTTACCGCGGGGATTTGCGACGGTGTCTTGGCCGCGGGGTGAGC
GAGGGGGAGTGGGCGGAGAAGAATATCGTCGTGGTTATTTGTGGGGGGTCGGGCGTCACGTTGGGCATTTTGGAT
CAGTATCGGCGGGAGTATGGGTCGTTGGCGAGTATCAAGGCGTGA
Transcript >Ophun1|5203
ATGGGCTCCCTCGGATCCGAAGCGAAGCTCCCCTGGCACCAGACGCCATGCGTCCTCAGCCCCCAGCTATCGCGC
CTCGCCGGCTGCAACATCTATCTCAAGCTCGACAATCTTCAGCCCAGCGGTTCCTTCAAGTCCCGCGGTATCGGT
AACTTGATGACGCGCGCTGCCGCCACAGCAACCGGCCCTGTCCACTTCTACTGCTCGTCCGGCGGCAACGCGGGT
CTCGCATGCGCAACATCGGCCGTTGCATTACGCCGACCCGCCACCATTGTCGTGCCCGTCACGACATCAGAAATG
ATGAAGTCCAAGCTGCTCGACCTCGGCGTCCAAGTCTATCAAGTGGGCAAGAACCTGGCGGCGGCAGACGACTAC
CTGCGTAACGAGCTCCTGGCCAACGACCCAGACGGCGTCTACGTGCCCCCTTACGACCACCCTCACGTATGGGAC
GGAGCAGCATCCATCGTGGGCGAGCTACGAGAGCAGCTCGAAGTGCCCATCGACGCCATCGTCTGCAGCGTCGGC
GGCGGCGGCCTCTTCAACGGCCTCATGCAAGGCATCGAAGCCTTCCCCTGGTCCGGCAGCAAGCCCGACGTCGTA
TGCGTCGAGACAGCCGGCGCAGATAGTCTCAACGCATCGGTCCGAGCAGGCACCCACGTGACGCTCCCAGAGATA
ACCTCCATCGCCACCTCCCTCGGCTGCTCGCGCGTCTCCACCGAATCATGGCGCTGGATCCAACGACCCAACACG
CACAGCCTCGTCGTCTCAGACGCCGACGCCGCCCTCAGCTGCGTCCGATTCGCAGACGACGCCCGCCATCTGGTC
GAGGTATCGTGCGGTGCCGCGCTGGCAGCTGTTTACCGCGGGGATTTGCGACGGTGTCTTGGCCGCGGGGTGAGC
GAGGGGGAGTGGGCGGAGAAGAATATCGTCGTGGTTATTTGTGGGGGGTCGGGCGTCACGTTGGGCATTTTGGAT
CAGTATCGGCGGGAGTATGGGTCGTTGGCGAGTATCAAGGCGTGA
Gene >Ophun1|5203
ATGGGCTCCCTCGGATCCGAAGCGAAGCTCCCCTGGCACCAGACGCCATGCGTCCTCAGCCCCCAGCTATCGCGC
CTCGCCGGCTGGTGACTTTCCCTTCCTCTCTCTTTACCTTTCCTGTCTAACCTCGAGCCAGCAACATCTATCTCA
AGCTCGACAATCTTCAGCCCAGCGGTTCCTTCAAGTCCCGCGGTATCGGTAACTTGATGACGCGCGCTGCCGCCA
CAGCAACCGGCCCTGTCCACTTCTACTGCTCGTCCGGCGGCAACGCGGGTCTCGCATGCGCAACATCGGCCGTTG
CATTACGCCGACCCGCCACCATTGTCGTGCCCGTCACGACATCAGAAATGATGAAGTCCAAGCTGCTCGACCTCG
GCGTCCAAGTCTATCAAGTGGGCAAGAACCTGGCGGCGGCAGACGACTACCTGCGTAACGAGCTCCTGGCCAACG
ACCCAGACGGCGTCTACGTGCCCCCTTACGACCACCCTCACGTATGGGACGGAGCAGCATCCATCGTGGGCGAGC
TACGAGAGCAGCTCGAAGTGCCCATCGACGCCATCGTCTGCAGCGTCGGCGGCGGCGGCCTCTTCAACGGCCTCA
TGCAAGGCATCGAAGCCTTCCCCTGGTCCGGCAGCAAGCCCGACGTCGTATGCGTCGAGACAGCCGGCGCAGATA
GTCTCAACGCATCGGTCCGAGCAGGCACCCACGTGACGCTCCCAGAGATAACCTCCATCGCCACCTCCCTCGGCT
GCTCGCGCGTCTCCACCGAATCATGGCGCTGGATCCAACGACCCAACACGCACAGCCTCGTCGTCTCAGACGCCG
ACGCCGCCCTCAGCTGCGTCCGATTCGCAGACGACGCCCGCCATCTGGTCGAGGTATCGTGCGGTGCCGCGCTGG
CAGCTGTTTACCGCGGGGATTTGCGACGGTGTCTTGGCCGCGGGGTGAGCGAGGGGGAGTGGGCGGAGAAGAATA
TCGTCGTGGTTATTTGTGGGGGGTCGGGCGTCACGTTGGGCATTTTGGATCAGTATCGGCGGGAGTATGGGTCGT
TGGCGAGTATCAAGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail