Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5202
Gene name
LocationContig_50:24099..27645
Strand+
Gene length (bp)3546
Transcript length (bp)2847
Coding sequence length (bp)2847
Protein length (aa) 949

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 5.4E-19 590 665
PF01822 WSC WSC domain 1.9E-14 701 779
PF15630 CENP-S CENP-S protein 2.3E-31 852 927
PF00141 peroxidase Peroxidase 6.6E-22 56 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 4 786 0.0E+00
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 575 787 5.0E-29
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 698 849 2.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 586 792 9.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 563 787 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 4 786 0.0E+00
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 575 787 5.0E-29
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 698 849 2.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 586 792 9.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 563 787 7.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 695 849 2.0E-17
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 58 234 8.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 576 674 1.0E-14
sp|Q9D084|CENPS_MOUSE Centromere protein S OS=Mus musculus GN=Apitd1 PE=2 SV=1 852 937 1.0E-14
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 65 255 5.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 584 787 7.0E-14
sp|Q8N2Z9|CENPS_HUMAN Centromere protein S OS=Homo sapiens GN=APITD1 PE=1 SV=1 852 937 7.0E-13
sp|Q2TBR7|CENPS_BOVIN Centromere protein S OS=Bos taurus GN=APITD1 PE=2 SV=1 851 928 1.0E-12
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 60 191 1.0E-11
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 587 789 2.0E-11
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 587 789 2.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 589 750 6.0E-11
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 65 286 1.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 589 750 2.0E-10
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 589 702 2.0E-10
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 65 238 2.0E-10
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 65 255 3.0E-10
sp|E1BSW7|CENPS_CHICK Centromere protein S OS=Gallus gallus GN=APITD1 PE=1 SV=2 848 928 7.0E-10
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 589 687 9.0E-10
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 65 253 9.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 580 750 2.0E-09
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 65 293 2.0E-09
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 65 194 2.0E-09
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 65 238 3.0E-09
sp|Q3E835|MHF1_YEAST MHF histone-fold complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MHF1 PE=1 SV=1 853 927 3.0E-09
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 65 255 5.0E-09
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 701 839 6.0E-09
sp|Q6NRI8|CENPS_XENLA Centromere protein S OS=Xenopus laevis GN=apitd1 PE=2 SV=1 852 927 8.0E-09
sp|Q5AL63|MHF1_CANAL MHF histone-fold complex subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MHF1 PE=3 SV=1 848 927 8.0E-09
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 65 255 9.0E-09
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 65 238 1.0E-08
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 65 238 2.0E-08
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 65 289 3.0E-08
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 65 254 3.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 573 804 3.0E-08
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 65 194 5.0E-08
sp|O74807|MHF1_SCHPO MHF histone-fold complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mhf1 PE=1 SV=2 869 934 6.0E-08
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 59 237 2.0E-07
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 65 194 2.0E-07
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 59 228 3.0E-07
sp|Q9FL16|PER63_ARATH Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1 29 219 5.0E-07
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 59 228 5.0E-07
sp|O81772|PER46_ARATH Peroxidase 46 OS=Arabidopsis thaliana GN=PER46 PE=3 SV=1 47 220 7.0E-07
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 672 844 8.0E-07
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 672 844 1.0E-06
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 65 195 1.0E-06
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 65 194 1.0E-06
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 65 194 2.0E-06
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 65 194 2.0E-06
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 65 286 3.0E-06
sp|Q9SK52|PER18_ARATH Peroxidase 18 OS=Arabidopsis thaliana GN=PER18 PE=3 SV=1 63 217 4.0E-06
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 65 298 5.0E-06
sp|Q9LNL0|PER8_ARATH Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1 58 202 5.0E-06
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 65 286 5.0E-06
sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 33 191 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0071821 FANCM-MHF complex Yes
GO:0004601 peroxidase activity Yes
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0050896 response to stimulus No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016491 oxidoreductase activity No
GO:0006950 response to stress No
GO:0016209 antioxidant activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5202
MRSSSLLLALAASSIADPTWPSPTDELEEIMYQLFSFGARKFADTVSPCSNEASGPGRQNAAEWLRAAFHDAATA
NTYFGTGGVDGSLQYELNSGENAGPGQRTTLEFMAPYVSSRASLADLIALGVYTSVRSCGGPAVPFRAGRRDAVA
AGSLGVPQPENSAFTFQQQFERIGFSKEEMIQVTACGHTIGGVHQPDFPDIVPRGGLGNGEAPSDSTVDKFDNKV
VTEYLAGKTENPLVVGPAARINKNSDFKVFNSDGNKTVQAMADPDVFAATCKKVLQKLMDVVPPGVVLSDPVVPY
AVKPVGLQLTLTDGGSTLAWRGRIRVRTNTDGAGDIKSITITYKDRTGSCPSSSSCTIDSTVQGVGRGFDDNFAF
FPIEASIPASSGISSFVVTLRRADGSTSLYDNNGKGYPLQDDIIFQAPQSCVLPSTGALTITAAVRNDLAASGAR
TQIWYREPQSNSPVPRLSLAEVPLEKRRCVGDYTLFGAEFKIQGGLASQAHVDVLAGGGKGTDGFKRVAGFGGTC
AEFERAVECRDGKMLTERAVNETTAPASTAPASTAPVSSAPVTTAVVPPVVATHRPAVGGYRLVSCWTEGNQTRA
LSGVTFSNDTMTLDKCMEFCSKYNYWGTEYGRECYCGNSVSPSSDKAPLSDCNMPCGGNSSEYCGAGNRLELYST
TSAPATPTPTATLTHKATVAASYTLVGCMAEPTSARALSHKTTLDSKTTANEGCAAACGGSRYFGTEYGGECYCG
SFVNGGARPAPLTECNMPCGGDAYQYCGGSDRLELYENNNATGGTPQQPPTVADFVLVGCRTEGNGTRALSGRAA
AADDMSNGKCAGFCGGATFFGTEYGLQRLKSALWFAIGQMVDDESLRRDLNATPQFIGALTELVWTQIENVAVDL
ESFCHHAGRSTVTTADVLLLARKNSDLLTLMRAFVEERKGERGGVGRD*
Coding >Ophun1|5202
ATGCGGTCTTCATCCCTCTTACTGGCCCTCGCGGCCTCGTCCATCGCAGACCCAACATGGCCCTCCCCAACAGAC
GAACTCGAGGAAATCATGTACCAGCTCTTCTCCTTCGGAGCCCGCAAATTCGCAGACACAGTCAGCCCCTGCTCC
AACGAGGCTTCCGGACCAGGCCGGCAAAACGCAGCCGAGTGGCTCCGAGCCGCCTTCCATGACGCCGCAACGGCA
AACACGTATTTCGGCACGGGCGGCGTCGACGGCTCGCTGCAGTATGAGCTGAATAGCGGCGAGAACGCCGGACCG
GGACAGAGGACGACGCTGGAATTCATGGCGCCGTATGTGTCTTCGCGGGCCAGTCTCGCCGACTTGATAGCGCTG
GGGGTGTATACTTCGGTGCGGTCCTGCGGTGGACCCGCCGTTCCGTTCCGTGCCGGGAGGCGTGATGCCGTGGCG
GCGGGGAGTCTCGGCGTGCCGCAGCCGGAGAACTCGGCCTTTACCTTTCAGCAGCAGTTTGAGCGCATTGGCTTC
TCAAAGGAGGAGATGATTCAGGTGACGGCCTGCGGGCATACCATCGGCGGCGTCCACCAGCCTGATTTTCCGGAC
ATAGTGCCCCGGGGCGGCCTCGGCAACGGCGAGGCCCCCTCCGACTCTACCGTCGACAAGTTTGATAACAAGGTC
GTGACTGAGTATCTGGCCGGCAAGACGGAGAACCCGCTGGTGGTCGGTCCGGCGGCAAGGATCAACAAGAACTCG
GACTTTAAGGTCTTCAACTCGGATGGGAACAAGACGGTGCAGGCCATGGCTGATCCGGATGTCTTTGCGGCTACC
TGCAAGAAGGTGCTGCAGAAGTTGATGGACGTGGTTCCCCCCGGCGTCGTCCTGTCTGACCCTGTCGTTCCCTAC
GCCGTCAAGCCCGTTGGTCTGCAGCTTACTCTTACGGACGGAGGCTCGACCCTGGCTTGGAGGGGACGGATCCGC
GTGAGGACGAACACGGATGGAGCGGGCGACATCAAGAGCATCACCATCACGTACAAGGACCGCACCGGCAGCTGC
CCCAGCTCATCATCGTGCACCATCGACAGCACCGTCCAGGGCGTAGGCCGTGGCTTCGACGACAACTTTGCCTTC
TTCCCCATCGAGGCCTCCATCCCAGCCTCATCCGGCATCTCATCCTTCGTCGTCACGCTACGACGTGCCGATGGC
TCGACCTCCCTTTACGACAACAACGGAAAGGGATATCCCCTTCAAGACGACATCATCTTCCAAGCACCGCAAAGC
TGCGTCCTCCCTTCGACCGGAGCCCTCACCATCACAGCCGCCGTCCGAAACGACTTGGCAGCCAGCGGAGCCCGC
ACCCAAATCTGGTACCGCGAGCCACAGAGCAACAGCCCCGTTCCGCGCCTCAGCCTCGCTGAAGTACCGCTTGAG
AAGCGCCGGTGCGTTGGCGATTACACGCTCTTCGGCGCTGAGTTTAAGATTCAGGGGGGTCTTGCGTCGCAGGCT
CACGTTGATGTTTTGGCGGGGGGTGGGAAGGGCACGGATGGGTTTAAGAGGGTGGCTGGCTTTGGGGGGACGTGC
GCTGAGTTTGAGCGGGCGGTTGAGTGTCGTGATGGTAAGATGCTGACGGAGAGGGCGGTCAACGAGACGACGGCT
CCGGCTTCTACGGCTCCGGCTTCGACAGCTCCGGTTTCTTCGGCCCCCGTCACTACAGCCGTGGTGCCTCCGGTT
GTGGCCACGCACCGGCCGGCGGTTGGCGGCTATCGGCTCGTGTCGTGCTGGACCGAGGGCAACCAGACGCGTGCA
CTGAGCGGCGTGACGTTTAGCAACGACACCATGACGCTGGATAAGTGCATGGAGTTTTGCAGCAAGTACAACTAC
TGGGGCACCGAGTACGGACGAGAGTGCTACTGCGGCAACTCCGTCTCCCCCAGCAGCGACAAGGCTCCCCTCTCA
GACTGCAACATGCCCTGCGGCGGCAACAGCAGCGAGTACTGCGGCGCGGGCAATCGCCTAGAGCTCTACTCAACC
ACCAGCGCGCCCGCGACGCCAACACCAACGGCAACGCTGACGCACAAGGCCACCGTCGCAGCCTCGTACACGCTG
GTAGGCTGCATGGCGGAACCGACGTCAGCCCGCGCTCTATCCCACAAGACAACACTCGACAGCAAGACGACGGCC
AACGAAGGCTGCGCCGCCGCGTGCGGAGGATCGCGGTACTTTGGGACGGAGTACGGCGGCGAGTGTTACTGCGGA
AGCTTCGTCAATGGGGGCGCGCGTCCTGCTCCGCTCACAGAATGCAATATGCCCTGCGGCGGAGACGCGTACCAA
TACTGCGGCGGATCAGACAGACTGGAACTGTACGAAAACAACAACGCAACGGGCGGAACACCGCAGCAACCGCCG
ACGGTGGCAGACTTCGTCCTCGTCGGCTGCCGAACCGAAGGCAACGGCACGCGCGCGCTGTCCGGCCGGGCCGCT
GCGGCGGACGACATGAGCAACGGGAAGTGCGCTGGCTTCTGCGGCGGGGCGACCTTTTTCGGGACGGAGTATGGG
CTCCAGCGCCTCAAGTCAGCCCTCTGGTTCGCCATCGGCCAAATGGTAGACGACGAGTCCCTCCGCCGAGACCTG
AATGCCACGCCACAGTTCATCGGGGCGTTGACGGAGCTCGTCTGGACGCAGATCGAAAACGTGGCGGTTGACCTG
GAGAGCTTCTGCCATCATGCGGGTCGTTCGACCGTCACGACGGCGGATGTGCTCCTCCTGGCGCGCAAGAATTCG
GATTTGCTTACCTTGATGCGGGCTTTTGTTGAGGAGAGGAAGGGGGAGAGGGGGGGGGTGGGGAGGGATTGA
Transcript >Ophun1|5202
ATGCGGTCTTCATCCCTCTTACTGGCCCTCGCGGCCTCGTCCATCGCAGACCCAACATGGCCCTCCCCAACAGAC
GAACTCGAGGAAATCATGTACCAGCTCTTCTCCTTCGGAGCCCGCAAATTCGCAGACACAGTCAGCCCCTGCTCC
AACGAGGCTTCCGGACCAGGCCGGCAAAACGCAGCCGAGTGGCTCCGAGCCGCCTTCCATGACGCCGCAACGGCA
AACACGTATTTCGGCACGGGCGGCGTCGACGGCTCGCTGCAGTATGAGCTGAATAGCGGCGAGAACGCCGGACCG
GGACAGAGGACGACGCTGGAATTCATGGCGCCGTATGTGTCTTCGCGGGCCAGTCTCGCCGACTTGATAGCGCTG
GGGGTGTATACTTCGGTGCGGTCCTGCGGTGGACCCGCCGTTCCGTTCCGTGCCGGGAGGCGTGATGCCGTGGCG
GCGGGGAGTCTCGGCGTGCCGCAGCCGGAGAACTCGGCCTTTACCTTTCAGCAGCAGTTTGAGCGCATTGGCTTC
TCAAAGGAGGAGATGATTCAGGTGACGGCCTGCGGGCATACCATCGGCGGCGTCCACCAGCCTGATTTTCCGGAC
ATAGTGCCCCGGGGCGGCCTCGGCAACGGCGAGGCCCCCTCCGACTCTACCGTCGACAAGTTTGATAACAAGGTC
GTGACTGAGTATCTGGCCGGCAAGACGGAGAACCCGCTGGTGGTCGGTCCGGCGGCAAGGATCAACAAGAACTCG
GACTTTAAGGTCTTCAACTCGGATGGGAACAAGACGGTGCAGGCCATGGCTGATCCGGATGTCTTTGCGGCTACC
TGCAAGAAGGTGCTGCAGAAGTTGATGGACGTGGTTCCCCCCGGCGTCGTCCTGTCTGACCCTGTCGTTCCCTAC
GCCGTCAAGCCCGTTGGTCTGCAGCTTACTCTTACGGACGGAGGCTCGACCCTGGCTTGGAGGGGACGGATCCGC
GTGAGGACGAACACGGATGGAGCGGGCGACATCAAGAGCATCACCATCACGTACAAGGACCGCACCGGCAGCTGC
CCCAGCTCATCATCGTGCACCATCGACAGCACCGTCCAGGGCGTAGGCCGTGGCTTCGACGACAACTTTGCCTTC
TTCCCCATCGAGGCCTCCATCCCAGCCTCATCCGGCATCTCATCCTTCGTCGTCACGCTACGACGTGCCGATGGC
TCGACCTCCCTTTACGACAACAACGGAAAGGGATATCCCCTTCAAGACGACATCATCTTCCAAGCACCGCAAAGC
TGCGTCCTCCCTTCGACCGGAGCCCTCACCATCACAGCCGCCGTCCGAAACGACTTGGCAGCCAGCGGAGCCCGC
ACCCAAATCTGGTACCGCGAGCCACAGAGCAACAGCCCCGTTCCGCGCCTCAGCCTCGCTGAAGTACCGCTTGAG
AAGCGCCGGTGCGTTGGCGATTACACGCTCTTCGGCGCTGAGTTTAAGATTCAGGGGGGTCTTGCGTCGCAGGCT
CACGTTGATGTTTTGGCGGGGGGTGGGAAGGGCACGGATGGGTTTAAGAGGGTGGCTGGCTTTGGGGGGACGTGC
GCTGAGTTTGAGCGGGCGGTTGAGTGTCGTGATGGTAAGATGCTGACGGAGAGGGCGGTCAACGAGACGACGGCT
CCGGCTTCTACGGCTCCGGCTTCGACAGCTCCGGTTTCTTCGGCCCCCGTCACTACAGCCGTGGTGCCTCCGGTT
GTGGCCACGCACCGGCCGGCGGTTGGCGGCTATCGGCTCGTGTCGTGCTGGACCGAGGGCAACCAGACGCGTGCA
CTGAGCGGCGTGACGTTTAGCAACGACACCATGACGCTGGATAAGTGCATGGAGTTTTGCAGCAAGTACAACTAC
TGGGGCACCGAGTACGGACGAGAGTGCTACTGCGGCAACTCCGTCTCCCCCAGCAGCGACAAGGCTCCCCTCTCA
GACTGCAACATGCCCTGCGGCGGCAACAGCAGCGAGTACTGCGGCGCGGGCAATCGCCTAGAGCTCTACTCAACC
ACCAGCGCGCCCGCGACGCCAACACCAACGGCAACGCTGACGCACAAGGCCACCGTCGCAGCCTCGTACACGCTG
GTAGGCTGCATGGCGGAACCGACGTCAGCCCGCGCTCTATCCCACAAGACAACACTCGACAGCAAGACGACGGCC
AACGAAGGCTGCGCCGCCGCGTGCGGAGGATCGCGGTACTTTGGGACGGAGTACGGCGGCGAGTGTTACTGCGGA
AGCTTCGTCAATGGGGGCGCGCGTCCTGCTCCGCTCACAGAATGCAATATGCCCTGCGGCGGAGACGCGTACCAA
TACTGCGGCGGATCAGACAGACTGGAACTGTACGAAAACAACAACGCAACGGGCGGAACACCGCAGCAACCGCCG
ACGGTGGCAGACTTCGTCCTCGTCGGCTGCCGAACCGAAGGCAACGGCACGCGCGCGCTGTCCGGCCGGGCCGCT
GCGGCGGACGACATGAGCAACGGGAAGTGCGCTGGCTTCTGCGGCGGGGCGACCTTTTTCGGGACGGAGTATGGG
CTCCAGCGCCTCAAGTCAGCCCTCTGGTTCGCCATCGGCCAAATGGTAGACGACGAGTCCCTCCGCCGAGACCTG
AATGCCACGCCACAGTTCATCGGGGCGTTGACGGAGCTCGTCTGGACGCAGATCGAAAACGTGGCGGTTGACCTG
GAGAGCTTCTGCCATCATGCGGGTCGTTCGACCGTCACGACGGCGGATGTGCTCCTCCTGGCGCGCAAGAATTCG
GATTTGCTTACCTTGATGCGGGCTTTTGTTGAGGAGAGGAAGGGGGAGAGGGGGGGGGTGGGGAGGGATTGA
Gene >Ophun1|5202
ATGCGGTCTTCATCCCTCTTACTGGCCCTCGCGGCCTCGTCCATCGCAGACCCAACATGGCCCTCCCCAACAGAC
GAACTCGAGGAAATCATGTACCAGCTCTTCTCCTTCGGAGCCCGCAAATTCGCAGACACAGTCAGCCCCTGCTCC
AACGAGGCTTCCGGACCAGGCCGGCAAAACGCAGCCGAGTGGCTCCGAGCCGCCTTCCATGACGCCGCAACGGCA
AACACGTATTTCGGCACGGGCGGCGTCGACGGCTCGCTGCAGTATGAGCTGAATAGCGGCGAGAACGCCGGACCG
GGACAGAGGACGACGCTGGAATTCATGGCGCCGTATGTGTCTTCGCGGGCCAGTCTCGCCGACTTGATAGCGCTG
GGGGTGTATACTTCGGTGCGGTCCTGCGGTGGACCCGCCGTTCCGTTCCGTGCCGGGAGGCGTGATGCCGTGGCG
GCGGGGAGTCTCGGCGTGCCGCAGCCGGAGAACTCGGCCTTTACCTTTCAGCAGCAGTTTGAGCGCATTGGCTTC
TCAAAGGAGGAGATGATTCAGGTGACGGCCTGCGGGCATACCATCGGCGGCGTCCACCAGCCTGATTTTCCGGAC
ATAGTGCCCCGGGGCGGCCTCGGCAACGGCGAGGCCCCCTCCGACTCTACCGTCGACAAGTTTGATAACAAGGTC
GTGACTGAGTATCTGGCCGGCAAGACGGAGAACCCGCTGGTGGTCGGTCCGGCGGCAAGGATCAACAAGAACTCG
GACTTTAAGGTCTTCAACTCGGATGGGAACAAGACGGTGCAGGCCATGGCTGATCCGGATGTCTTTGCGGCTACC
TGCAAGAAGGTGCTGCAGAAGTTGATGGACGTGGTTCCCCCCGGCGTCGTCCTGTCTGACCCTGTCGTTCCCTAC
GCCGTCAAGCCCGTTGGTCTGCAGCTTACTCTTACGGACGGAGGCTCGACCCTGGCTTGGAGGGGACGGATCCGC
GTGAGGACGAACACGGATGGAGCGGGCGACATCAAGAGCATCACCATCACGTACAAGGACCGCACCGGCAGCTGC
CCCAGCTCATCATCGTGCACCATCGACAGCACCGTCCAGGGCGTAGGCCGTGGCTTCGACGACAACTTTGCCTTC
TTCCCCATCGAGGCCTCCATCCCAGCCTCATCCGGCATCTCATCCTTCGTCGTCACGCTACGACGTGCCGATGGC
TCGACCTCCCTTTACGACAACAACGGAAAGGGATATCCCCTTCAAGACGACATCATCTTCCAAGCACCGCAAAGC
TGCGTCCTCCCTTCGACCGGAGCCCTCACCATCACAGCCGCCGTCCGAAACGACTTGGCAGCCAGCGGAGCCCGC
ACCCAAATCTGGTACCGCGAGCCACAGAGCAACAGCCCCGTTCCGCGCCTCAGCCTCGCTGAAGTACCGCTTGAG
AAGCGCCGGTGCGTTGGCGATTACACGCTCTTCGGCGCTGAGTTTAAGATTCAGGGGGGTCTTGCGTCGCAGGCT
CACGTTGATGTTTTGGCGGGGGGTGGGAAGGGCACGGATGGGTTTAAGAGGGTGGCTGGCTTTGGGGGGACGTGC
GCTGAGTTTGAGCGGGCGGTTGAGTGTCGTGATGGTAAGATGCTGACGGAGAGGGCGGTCAACGAGACGACGGCT
CCGGCTTCTACGGCTCCGGCTTCGACAGCTCCGGTTTCTTCGGCCCCCGTCACTACAGCCGTGGTGCCTCCGGTT
GTGGCCACGCACCGGCCGGCGGTTGGCGGCTATCGGCTCGTGTCGTGCTGGACCGAGGGCAACCAGACGCGTGCA
CTGAGCGGCGTGACGTTTAGCAACGACACCATGACGCTGGATAAGTGCATGGAGTTTTGCAGCAAGTACAACTAC
TGGGGCACCGAGTACGGACGAGAGTGTAAGTTGCTTCTGAGATACATCAGACATGATACTCGTACTGATCAGACT
TCCCAGGCTACTGCGGCAACTCCGTCTCCCCCAGCAGCGACAAGGCTCCCCTCTCAGACTGCAACATGCCCTGCG
GCGGCAACAGCAGCGAGTACTGCGGCGCGGGCAATCGCCTAGAGCTCTACTCAACCACCAGCGCGCCCGCGACGC
CAACACCAACGGCAACGCTGACGCACAAGGCCACCGTCGCAGCCTCGTACACGCTGGTAGGCTGCATGGCGGAAC
CGACGTCAGCCCGCGCTCTATCCCACAAGACAACACTCGACAGCAAGACGACGGCCAACGAAGGCTGCGCCGCCG
CGTGCGGAGGATCGCGGTACTTTGGGACGGAGTACGGCGGCGAGTGTTACTGCGGAAGCTTCGTCAATGGGGGCG
CGCGTCCTGCTCCGCTCACAGAATGCAATATGCCCTGCGGCGGAGACGCGTACCAATACTGCGGCGGATCAGACA
GACTGGAACTGTACGAAAACAACAACGCAACGGGCGGAACACCGCAGCAACCGCCGACGGTGGCAGACTTCGTCC
TCGTCGGCTGCCGAACCGAAGGCAACGGCACGCGCGCGCTGTCCGGCCGGGCCGCTGCGGCGGACGACATGAGCA
ACGGGAAGTGCGCTGGCTTCTGCGGCGGGGCGACCTTTTTCGGGACGGAGTATGGGCGTGAGTGCTATTGCGGTG
ATGGGCTCGATGCTTCGAGCAAGGTTGCGCCTGCGGAGGAGTGTGGCATGGTGTGTGCTGGGGATGCGAGGCAGC
TTTGTGGTGCGGCGAATCGGCTTTCGGTTTATCGGAGGGGGGGGACGCCTCCGGTTGTGCCGCCTCCGGGGCTGT
GAGGATGGGATTGTGGTGGTTGGTGGAGTGTTGTCGAGATGGTTGTTGTGTTGCGAGCTGTGGGGATAGTGCGGT
TGTCGGTCTGTGATGTGTAAGCGAGAGCAGGATGGTGATTTCAGAATGAGCAAGCGCTCAGACAGACATGACGCG
ATGACGACTCCCAGTCTAGATATTCTCATGGCTGAAGCACCTTGAGGCTCGACGTTGAAGCACCAAAATATCTCC
CAGCCAAGCCCCACCCAAACACGAGATTTTGCTCATCTCACCAACCCTGACTAATCCACTTCTCTCACCACCACT
CACCATCAGCATCACGCTTCTCACCACAATACAATGGCAGACGCGTCCCCAGACCGCGAGGCGCGCCACCCCAAA
CCACCCGCTGACCACCCCCCAACTAACACCAAGTCCAGCGCCTCAAGTCAGCCCTCTGGTTCGCCATCGGCCAAA
TGGTAGACGACGAGTCCCTCCGCCGAGACCTGAATGCCACGCCACAGTTCATCGGGGCGTTGACGGAGCTCGTCT
GGACGCAGATCGGTACTTTCCCATCTATCCCATCATTGCCGTCATCTCTTTATATTCATTCGTGGCTGATGACGG
GTAGAAAACGTGGCGGTTGACCTGGAGAGCTTCTGCCATCATGCGGGTCGTTCGACCGTCACGACGGCGGATGTG
CTCCTCCTGGCGCGCAAGAATTCGGATTTGCTTACCTTGATGCGGGCTTTTGTTGAGGAGAGGAAGGGGGAGAGG
GGGGGGGTGGGGAGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail