Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|52
Gene name
LocationContig_1:131750..133462
Strand-
Gene length (bp)1712
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08321 PPP5 PPP5 TPR repeat region 5.8E-33 113 203
PF00149 Metallophos Calcineurin-like phosphoesterase 6.4E-29 212 405
PF00515 TPR_1 Tetratricopeptide repeat 9.1E-07 73 106
PF13181 TPR_8 Tetratricopeptide repeat 3.4E-02 74 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 1 464 0.0E+00
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 5 464 3.0E-170
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 5 464 6.0E-170
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 5 464 3.0E-169
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 5 463 5.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 1 464 0.0E+00
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 5 464 3.0E-170
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 5 464 6.0E-170
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 5 464 3.0E-169
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 5 463 5.0E-151
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 4 464 6.0E-139
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 148 463 1.0E-114
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 161 441 6.0E-65
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 161 441 1.0E-63
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 166 441 4.0E-63
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 161 441 1.0E-62
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 158 441 3.0E-62
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 161 450 1.0E-61
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 161 441 1.0E-61
sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 148 463 1.0E-61
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 157 463 2.0E-61
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 192 441 2.0E-61
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 161 441 6.0E-61
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 161 454 1.0E-60
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 166 456 2.0E-60
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 192 441 4.0E-60
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 166 456 5.0E-60
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 166 456 5.0E-60
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 166 456 5.0E-60
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 166 456 5.0E-60
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 166 450 5.0E-60
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 161 441 6.0E-60
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 166 456 6.0E-60
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 166 476 6.0E-60
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 153 450 7.0E-60
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 184 441 7.0E-60
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 184 441 7.0E-60
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 184 441 7.0E-60
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 184 441 7.0E-60
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 184 441 7.0E-60
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 184 441 7.0E-60
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 184 441 7.0E-60
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 184 441 7.0E-60
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 184 441 7.0E-60
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 184 441 7.0E-60
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 184 441 7.0E-60
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 187 441 7.0E-60
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 187 441 7.0E-60
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 166 464 7.0E-60
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 187 441 8.0E-60
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 187 441 8.0E-60
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 187 441 8.0E-60
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 187 441 8.0E-60
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 166 441 9.0E-60
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 166 441 9.0E-60
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 166 456 9.0E-60
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 187 441 9.0E-60
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 166 441 9.0E-60
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 166 441 1.0E-59
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 166 441 1.0E-59
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 166 441 1.0E-59
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 166 441 1.0E-59
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 166 456 1.0E-59
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 157 441 1.0E-59
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 166 456 1.0E-59
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 187 441 1.0E-59
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 161 441 2.0E-59
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 161 441 2.0E-59
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 192 441 2.0E-59
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 166 441 3.0E-59
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 166 456 3.0E-59
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 192 441 3.0E-59
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 157 456 3.0E-59
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 157 463 4.0E-59
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 158 441 5.0E-59
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 166 456 6.0E-59
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 166 464 6.0E-59
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 158 456 1.0E-58
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 158 456 1.0E-58
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 158 456 1.0E-58
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 158 456 1.0E-58
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 166 450 1.0E-58
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 158 456 1.0E-58
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 158 456 1.0E-58
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 177 456 2.0E-58
sp|O14829|PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 143 463 2.0E-58
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 166 464 3.0E-58
sp|O35655|PPE1_MOUSE Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 148 463 3.0E-58
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 192 441 6.0E-58
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 192 441 6.0E-58
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 160 457 1.0E-57
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 178 441 4.0E-57
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 187 441 6.0E-57
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 160 457 6.0E-57
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 187 441 8.0E-57
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 166 459 8.0E-57
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 166 456 1.0E-56
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 166 456 1.0E-56
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 184 441 1.0E-56
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 166 456 3.0E-56
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 166 456 3.0E-56
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 166 456 4.0E-56
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 166 456 4.0E-56
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 166 456 5.0E-56
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 166 456 5.0E-56
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 161 470 5.0E-56
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 166 460 5.0E-56
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 160 462 7.0E-56
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 187 441 7.0E-56
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 166 456 8.0E-56
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 166 456 1.0E-55
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 166 462 1.0E-55
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 166 462 1.0E-55
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 166 462 1.0E-55
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 173 462 2.0E-55
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 166 461 3.0E-55
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 166 460 4.0E-55
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 166 460 4.0E-55
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 166 460 4.0E-55
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 169 458 5.0E-55
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 162 460 5.0E-55
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 161 454 6.0E-55
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 157 460 8.0E-55
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 166 460 2.0E-54
sp|Q8SRZ0|PP1L_ENCCU Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 141 443 2.0E-54
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 166 455 3.0E-54
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 166 457 5.0E-54
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 166 460 5.0E-54
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 207 462 6.0E-54
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 166 456 7.0E-54
sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 142 452 7.0E-54
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 166 460 8.0E-54
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 166 460 9.0E-54
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 166 456 9.0E-54
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 193 458 1.0E-53
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 173 458 1.0E-53
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 193 458 1.0E-53
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 166 460 1.0E-53
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 162 462 1.0E-53
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 166 457 2.0E-53
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 193 458 2.0E-53
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 193 458 2.0E-53
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 166 457 2.0E-53
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 166 457 2.0E-53
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 166 457 3.0E-53
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 184 453 4.0E-53
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 166 457 4.0E-53
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 166 457 4.0E-53
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 166 457 4.0E-53
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 166 457 4.0E-53
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 189 462 5.0E-53
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 166 461 7.0E-53
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 166 457 1.0E-52
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 184 449 1.0E-52
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 166 457 1.0E-52
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 166 457 2.0E-52
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 166 470 5.0E-52
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 216 441 6.0E-52
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 167 458 6.0E-52
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 166 455 9.0E-52
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 194 462 1.0E-51
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 166 457 2.0E-51
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 187 462 4.0E-51
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 169 462 5.0E-51
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 166 441 8.0E-51
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 167 462 2.0E-50
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 178 462 4.0E-50
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 166 454 9.0E-50
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 191 458 1.0E-49
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 167 461 3.0E-49
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 184 455 3.0E-49
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 161 444 3.0E-49
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 174 450 4.0E-49
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 166 456 5.0E-49
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 166 455 9.0E-49
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 158 459 9.0E-49
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 166 459 7.0E-48
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 166 462 8.0E-48
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 167 460 1.0E-47
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 184 462 3.0E-47
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 166 429 3.0E-47
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 166 429 3.0E-47
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 207 429 4.0E-47
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 184 462 9.0E-47
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 184 455 3.0E-46
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 161 418 1.0E-45
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 82 458 2.0E-45
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 189 456 2.0E-45
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 166 456 3.0E-45
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 190 462 1.0E-44
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 163 458 2.0E-44
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 190 462 2.0E-44
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 134 450 6.0E-44
sp|Q9FN02|PPP7_ARATH Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 186 462 4.0E-43
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 184 441 5.0E-43
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 190 462 7.0E-43
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 166 440 1.0E-42
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 166 440 3.0E-42
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 166 440 8.0E-42
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 139 347 6.0E-38
sp|P48460|YY06_CAEEL Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 184 447 4.0E-37
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 142 340 3.0E-35
sp|Q9LNG5|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 186 458 3.0E-31
sp|Q9LEV0|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 157 443 5.0E-31
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 5 146 2.0E-25
sp|P34350|YK84_CAEEL Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 164 459 2.0E-22
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 352 454 1.0E-17
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 340 454 4.0E-17
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 9 118 2.0E-16
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 9 119 7.0E-16
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 2 117 4.0E-15
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 5 106 8.0E-15
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 2 136 9.0E-15
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 8 118 1.0E-14
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 2 124 1.0E-14
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 4 124 2.0E-14
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 4 124 2.0E-14
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 1 124 2.0E-14
sp|E7EU14|PP5D1_HUMAN Protein PPP5D1 OS=Homo sapiens GN=PPP5D1 PE=2 SV=2 100 186 2.0E-14
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 4 124 2.0E-14
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 2 116 3.0E-14
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 2 116 3.0E-14
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 4 121 6.0E-14
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 4 118 9.0E-14
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 2 120 1.0E-13
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 4 123 1.0E-13
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 4 122 1.0E-13
sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 2 107 1.0E-13
sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 2 107 2.0E-13
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 2 109 2.0E-13
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 9 117 2.0E-13
sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=1 SV=1 4 108 2.0E-13
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 4 146 3.0E-13
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 5 106 5.0E-13
sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 3 108 7.0E-13
sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 5 116 9.0E-13
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 4 123 1.0E-12
sp|Q863A7|DYXC1_PANTR Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan troglodytes GN=DYX1C1 PE=3 SV=1 8 121 1.0E-12
sp|Q863A5|DYXC1_GORGO Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Gorilla gorilla gorilla GN=DYX1C1 PE=3 SV=1 8 121 1.0E-12
sp|Q863A6|DYXC1_PANPA Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan paniscus GN=DYX1C1 PE=3 SV=1 8 121 1.0E-12
sp|Q863A4|DYXC1_PONPY Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pongo pygmaeus GN=DYX1C1 PE=3 SV=1 8 121 1.0E-12
sp|Q8WXU2|DYXC1_HUMAN Dyslexia susceptibility 1 candidate gene 1 protein OS=Homo sapiens GN=DYX1C1 PE=1 SV=2 8 121 2.0E-12
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 4 123 2.0E-12
sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1 7 107 2.0E-12
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 4 118 3.0E-12
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 5 120 4.0E-12
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 4 118 5.0E-12
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 5 124 6.0E-12
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 9 121 6.0E-12
sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 4 107 9.0E-12
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 4 118 1.0E-11
sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 1 107 1.0E-11
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 8 122 1.0E-11
sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 OS=Mus musculus GN=Ttc28 PE=1 SV=3 11 106 1.0E-11
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 5 123 1.0E-11
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 5 116 1.0E-11
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 9 124 1.0E-11
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 9 118 2.0E-11
sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 11 106 2.0E-11
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 5 107 2.0E-11
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 2 134 3.0E-11
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 9 106 3.0E-11
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 5 121 3.0E-11
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 5 116 3.0E-11
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 5 116 4.0E-11
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 9 121 4.0E-11
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 5 116 6.0E-11
sp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana GN=SGT1A PE=1 SV=1 27 122 9.0E-11
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 9 123 1.0E-10
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 1 116 1.0E-10
sp|Q5VJS5|DYXC1_RAT Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Rattus norvegicus GN=Dyx1c1 PE=1 SV=1 8 121 1.0E-10
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 5 116 1.0E-10
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 5 116 1.0E-10
sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 9 95 2.0E-10
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 9 95 2.0E-10
sp|Q8R368|DYXC1_MOUSE Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Mus musculus GN=Dyx1c1 PE=1 SV=2 8 125 2.0E-10
sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 6 107 2.0E-10
sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 9 95 2.0E-10
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 5 82 2.0E-10
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 5 110 2.0E-10
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 9 108 4.0E-10
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 8 120 1.0E-09
sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 6 107 1.0E-09
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 5 114 2.0E-09
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 5 106 2.0E-09
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 1 132 3.0E-09
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 9 108 4.0E-09
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 4 117 5.0E-09
sp|Q9SRS9|CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana GN=CHIP PE=1 SV=1 2 98 6.0E-09
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 4 106 1.0E-08
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 4 106 1.0E-08
sp|Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens GN=STUB1 PE=1 SV=2 2 102 1.0E-08
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 4 106 2.0E-08
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 4 106 2.0E-08
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 4 106 2.0E-08
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 8 104 2.0E-08
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 8 104 2.0E-08
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 5 103 2.0E-08
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 9 103 2.0E-08
sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 8 124 2.0E-08
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 9 117 2.0E-08
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 8 118 2.0E-08
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 8 118 3.0E-08
sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=1 SV=1 8 107 4.0E-08
sp|P25407|STI1L_PLAFA STI1-like protein (Fragment) OS=Plasmodium falciparum PE=4 SV=1 4 107 5.0E-08
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 9 108 6.0E-08
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 9 107 6.0E-08
sp|Q9WUD1|CHIP_MOUSE STIP1 homology and U box-containing protein 1 OS=Mus musculus GN=Stub1 PE=1 SV=1 2 102 6.0E-08
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=1 SV=1 8 106 7.0E-08
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 4 123 1.0E-07
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 4 106 1.0E-07
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 5 123 1.0E-07
sp|P38825|TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM71 PE=1 SV=1 5 96 1.0E-07
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 9 123 2.0E-07
sp|Q93YR3|F10AL_ARATH FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1 5 103 2.0E-07
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 11 82 3.0E-07
sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 8 122 3.0E-07
sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 8 122 4.0E-07
sp|Q54M20|TTC4_DICDI Tetratricopeptide repeat protein 4 homolog OS=Dictyostelium discoideum GN=ttc4 PE=3 SV=1 2 118 4.0E-07
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 4 107 6.0E-07
sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 8 122 6.0E-07
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 4 120 7.0E-07
sp|P33313|CNS1_YEAST Hsp70/Hsp90 co-chaperone CNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNS1 PE=1 SV=1 5 107 9.0E-07
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 12 134 1.0E-06
sp|O13754|CNS1_SCHPO Hsp70/Hsp90 co-chaperone cns1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cns1 PE=3 SV=1 5 106 1.0E-06
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 4 157 1.0E-06
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 11 96 2.0E-06
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 4 120 2.0E-06
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 4 120 2.0E-06
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 4 123 3.0E-06
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 1 103 3.0E-06
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 8 109 3.0E-06
sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 4 122 3.0E-06
sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 4 122 3.0E-06
sp|Q5ZHY5|CHIP_CHICK STIP1 homology and U box-containing protein 1 OS=Gallus gallus GN=STUB1 PE=2 SV=1 2 102 3.0E-06
sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 4 122 4.0E-06
sp|Q86DS1|F10A2_DROME Hsc70-interacting protein 2 OS=Drosophila melanogaster GN=HIP-R PE=1 SV=2 4 103 4.0E-06
sp|C4NYP8|F10A1_DROME Hsc70-interacting protein 1 OS=Drosophila melanogaster GN=HIP PE=1 SV=2 4 103 4.0E-06
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 6 120 4.0E-06
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 5 95 5.0E-06
sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 4 122 7.0E-06
sp|F4JS25|SRFR1_ARATH Suppressor of RPS4-RLD 1 OS=Arabidopsis thaliana GN=SRFR1 PE=1 SV=1 28 108 7.0E-06
sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 4 122 7.0E-06
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 8 103 8.0E-06
sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus GN=Tomm34 PE=1 SV=1 8 110 8.0E-06
sp|B0BN85|SGT1_RAT Protein SGT1 homolog OS=Rattus norvegicus GN=Sugt1 PE=2 SV=1 15 161 8.0E-06
sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 4 122 8.0E-06
sp|Q9CX34|SGT1_MOUSE Protein SGT1 homolog OS=Mus musculus GN=Sugt1 PE=1 SV=3 15 119 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|52
MSPEAVNLKNQGNKAFAAGDFPAAVTFYTKAIALDDKEPTFFTNRAQAHIKAEAYGYAISDAGKAIELNPKLVKA
YYRRGLARTAILKPKDAIEDFKECVKLDPNNKDARLKLEECKKIVRQMAFFAAIEVGDEPSAAEGLDLDSMVVED
DYDGVRLESEMTQEFIDDMMERFKNGKKIHRKYVYQIVIAVKRVVYEEATMVEMEIPDDVQLTVCGDTHGQYFDL
MELFRRNGLPTERHWYLFNGDFVDRGSWSTEIALLLYAFKWLRPNCFFLNRGNHETDDMNRVYGFEGECKAKYNE
RVFKLFSESFSALPLATLVGKKYLVLHGGLFSDDNITLDDIRKLNRHNQRQPGQSGLMMEMLWTDPQEDQGRGPS
KRGVGMQFGPDVTRRFCDRNGLEAVIRSHEVRMDGYEVQHDGKCITVFSAPKYCDSTENRGAYINIGPDYKLHYE
QFDAVPHPDIRPMVCHDPEPVSPIVG*
Coding >Ophun1|52
ATGTCGCCAGAAGCCGTCAACTTGAAGAACCAAGGGAACAAGGCATTCGCCGCGGGCGATTTCCCTGCTGCCGTC
ACCTTTTACACCAAGGCTATCGCTCTTGACGACAAGGAGCCGACCTTCTTCACGAACCGAGCTCAAGCACACATC
AAAGCTGAAGCATACGGGTATGCCATCTCCGACGCTGGAAAGGCCATCGAGTTGAATCCAAAACTCGTCAAGGCA
TATTATCGTCGAGGTCTCGCTCGTACGGCCATCCTCAAACCGAAAGATGCAATCGAAGACTTTAAAGAATGCGTC
AAGCTGGACCCCAATAACAAAGATGCACGCCTGAAGCTGGAAGAGTGCAAAAAGATTGTGCGCCAAATGGCCTTC
TTTGCTGCCATCGAGGTTGGAGATGAACCTTCCGCAGCCGAGGGCCTCGACTTGGACTCCATGGTTGTCGAGGAC
GACTACGATGGCGTGCGACTCGAGAGCGAAATGACGCAAGAATTCATCGACGACATGATGGAGAGATTCAAGAAT
GGAAAAAAGATTCACCGCAAATATGTTTACCAAATCGTCATCGCCGTTAAGCGTGTCGTCTACGAAGAGGCGACA
ATGGTCGAGATGGAGATACCCGATGACGTCCAGCTCACTGTTTGCGGTGACACTCATGGTCAATATTTCGACCTG
ATGGAGCTCTTCCGGCGCAACGGACTTCCGACAGAGAGACATTGGTATCTCTTCAATGGCGATTTCGTAGATCGT
GGATCTTGGTCTACAGAGATCGCCCTTTTACTGTATGCCTTCAAGTGGCTGCGTCCCAACTGCTTCTTCCTTAAC
AGAGGCAACCACGAGACGGACGACATGAATCGCGTCTATGGGTTCGAGGGAGAGTGCAAAGCCAAGTACAACGAG
CGCGTTTTCAAGCTCTTCTCAGAGAGTTTCTCTGCCTTGCCCTTGGCGACGTTGGTCGGCAAGAAATATCTGGTT
CTCCACGGCGGCCTGTTTTCCGATGATAACATTACGCTCGACGACATCCGCAAGCTGAACAGACACAACCAGCGA
CAGCCAGGCCAGTCGGGCCTGATGATGGAAATGCTATGGACAGACCCCCAAGAGGACCAAGGCCGTGGACCGAGC
AAGCGAGGCGTCGGCATGCAATTCGGCCCCGACGTCACTCGTCGATTCTGCGACAGGAATGGCCTCGAAGCCGTC
ATTCGCAGCCATGAAGTACGCATGGACGGCTACGAGGTGCAGCACGATGGGAAATGCATCACGGTTTTCTCGGCC
CCCAAGTACTGTGACTCGACTGAGAATCGGGGTGCTTATATCAACATCGGCCCCGACTACAAGCTCCATTACGAG
CAGTTTGACGCGGTGCCTCATCCGGACATCCGTCCCATGGTATGCCATGACCCCGAACCCGTCTCTCCCATCGTC
GGCTGA
Transcript >Ophun1|52
ATGTCGCCAGAAGCCGTCAACTTGAAGAACCAAGGGAACAAGGCATTCGCCGCGGGCGATTTCCCTGCTGCCGTC
ACCTTTTACACCAAGGCTATCGCTCTTGACGACAAGGAGCCGACCTTCTTCACGAACCGAGCTCAAGCACACATC
AAAGCTGAAGCATACGGGTATGCCATCTCCGACGCTGGAAAGGCCATCGAGTTGAATCCAAAACTCGTCAAGGCA
TATTATCGTCGAGGTCTCGCTCGTACGGCCATCCTCAAACCGAAAGATGCAATCGAAGACTTTAAAGAATGCGTC
AAGCTGGACCCCAATAACAAAGATGCACGCCTGAAGCTGGAAGAGTGCAAAAAGATTGTGCGCCAAATGGCCTTC
TTTGCTGCCATCGAGGTTGGAGATGAACCTTCCGCAGCCGAGGGCCTCGACTTGGACTCCATGGTTGTCGAGGAC
GACTACGATGGCGTGCGACTCGAGAGCGAAATGACGCAAGAATTCATCGACGACATGATGGAGAGATTCAAGAAT
GGAAAAAAGATTCACCGCAAATATGTTTACCAAATCGTCATCGCCGTTAAGCGTGTCGTCTACGAAGAGGCGACA
ATGGTCGAGATGGAGATACCCGATGACGTCCAGCTCACTGTTTGCGGTGACACTCATGGTCAATATTTCGACCTG
ATGGAGCTCTTCCGGCGCAACGGACTTCCGACAGAGAGACATTGGTATCTCTTCAATGGCGATTTCGTAGATCGT
GGATCTTGGTCTACAGAGATCGCCCTTTTACTGTATGCCTTCAAGTGGCTGCGTCCCAACTGCTTCTTCCTTAAC
AGAGGCAACCACGAGACGGACGACATGAATCGCGTCTATGGGTTCGAGGGAGAGTGCAAAGCCAAGTACAACGAG
CGCGTTTTCAAGCTCTTCTCAGAGAGTTTCTCTGCCTTGCCCTTGGCGACGTTGGTCGGCAAGAAATATCTGGTT
CTCCACGGCGGCCTGTTTTCCGATGATAACATTACGCTCGACGACATCCGCAAGCTGAACAGACACAACCAGCGA
CAGCCAGGCCAGTCGGGCCTGATGATGGAAATGCTATGGACAGACCCCCAAGAGGACCAAGGCCGTGGACCGAGC
AAGCGAGGCGTCGGCATGCAATTCGGCCCCGACGTCACTCGTCGATTCTGCGACAGGAATGGCCTCGAAGCCGTC
ATTCGCAGCCATGAAGTACGCATGGACGGCTACGAGGTGCAGCACGATGGGAAATGCATCACGGTTTTCTCGGCC
CCCAAGTACTGTGACTCGACTGAGAATCGGGGTGCTTATATCAACATCGGCCCCGACTACAAGCTCCATTACGAG
CAGTTTGACGCGGTGCCTCATCCGGACATCCGTCCCATGGTATGCCATGACCCCGAACCCGTCTCTCCCATCGTC
GGCTGA
Gene >Ophun1|52
ATGTCGCCAGAAGCCGTCAACTTGAAGAACCAAGGGAACAAGGCATTCGCCGCGGGCGATTTCCCTGCTGCCGTC
ACCTTTTACACCAAGGCTATCGCTCTTGACGACAAGGAGCCGACCTTCTTCACGAACCGAGCTCAAGTATGTGTC
GAATGCAATAATGGCTCAGCCCGAGTTCTGCATGGCAGATCTGACGTCTTTAGGCACACATCAAAGCTGAAGCAT
ACGGGTATGCCATCTCCGACGCTGGAAAGGCCATCGAGTTGAATCCAAAACTCGTCAAGGTAAGCCTTTACCGTC
ACGACAGTGCCTGGCTCGACGCCCAACAGCTCGCAGGCATATTATCGTCGAGGTCTCGCTCGTACGGCCATCCTC
AAACCGAAAGATGCAATCGAAGACTTTAAAGAATGCGTCAAGCTGGACCCCAATAACAAAGATGCACGCCTGAAG
CTGGAAGAGTGCAAAAAGATTGTGCGCCAAATGGCCTTCTTTGCTGCCATCGAGGTTGGAGATGAACCTTCCGCA
GCCGAGGGCCTCGACTTGGACTCCATGGTTGTCGAGGACGACTACGATGGCGTGCGACTCGAGAGCGAAATGACG
CAAGAATTCATCGACGACATGATGGAGAGATTCAAGAATGGAAAAAAGATTCACCGCAAATATGTTTACCAAATC
GTCATCGCCGTTAAGCGTGTCGTCTACGAAGAGGCGACAATGGTCGAGATGGAGATACCCGATGACGTCCAGCTC
ACTGTTTGCGGTGACACTCATGGTCAGATCAGGAGCTCTCTCTCCTTTGCCGAGCATTGCCTAATATCTACCTAG
GTCAATATTTCGACCTGATGGAGCTCTTCCGGCGCAACGGACTTCCGACAGAGAGACATTGGTATCTCTTCAATG
GCGATTTCGTAGATCGTGGATCTTGGTCTACAGAGATCGCCCTTTTACTGTATGCCTTCAAGTGGCTGCGTCCCA
ACTGCTTCTTCCTTAACAGAGGCAACCACGAGACGGACGACATGAATCGCGTCTATGGGTTCGAGGGAGAGTGCA
AAGCCAAGTACAACGAGCGGTGGGTGCCTCACCAGTGGCTACTCGCACGGAAACGCCGTCACTGACTTGCAAGCA
GCGTTTTCAAGCTCTTCTCAGAGAGTTTCTCTGCCTTGCCCTTGGCGACGTTGGTCGGCAAGAAATATCTGGTTC
TCCACGGCGGCCTGTTTTCCGATGATAACATTACGCTCGACGACATCCGCAAGCTGAACAGACACAACCAGCGAC
AGCCAGGCCAGTCGGGCCTGATGATGGAAATGCTATGGACAGACCCCCAAGAGGACCAAGGCCGTGGACCGAGCA
AGCGAGGCGTCGGCATGCAATTCGGCCCCGACGTCACTCGTCGATTCTGCGACAGGAATGGCCTCGAAGCCGTCA
TTCGCAGCCATGAAGTACGCATGGACGGCTACGAGGTGCAGCACGATGGGAAATGCATCACGGGTGCGCCACAGC
AAGGCCTGGATTCTCCAAGCTGATTTCACTGACAACTTGCTTTAGTTTTCTCGGCCCCCAAGTACTGTGACTCGA
CTGAGAATCGGGGTGCTTATATCAACATCGGCCCCGACTACAAGCTCCATTACGAGCAGTTTGACGCGGTGCCTC
ATCCGGACATCCGTCCCATGGTATGCCATGACCCCGAACCCGTCTCTCCCATCGTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail