Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5199
Gene name
LocationContig_50:17860..21288
Strand+
Gene length (bp)3428
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11882 DUF3402 Domain of unknown function (DUF3402) 2.1E-207 549 1044
PF07923 N1221 N1221-like protein 2.9E-95 134 441

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P5J8|STRP1_BOVIN Striatin-interacting protein 1 OS=Bos taurus GN=STRIP1 PE=2 SV=1 897 1020 4.0E-23
sp|Q9GLZ5|STRP1_MACFA Striatin-interacting protein 1 OS=Macaca fascicularis GN=STRIP1 PE=2 SV=1 897 1020 4.0E-23
sp|Q8C079|STRP1_MOUSE Striatin-interacting protein 1 OS=Mus musculus GN=Strip1 PE=1 SV=2 897 1020 4.0E-23
sp|Q5R7S4|STRP1_PONAB Striatin-interacting protein 1 OS=Pongo abelii GN=STRIP1 PE=2 SV=2 897 1020 4.0E-23
sp|Q5VSL9|STRP1_HUMAN Striatin-interacting protein 1 OS=Homo sapiens GN=STRIP1 PE=1 SV=1 897 1020 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P5J8|STRP1_BOVIN Striatin-interacting protein 1 OS=Bos taurus GN=STRIP1 PE=2 SV=1 897 1020 4.0E-23
sp|Q9GLZ5|STRP1_MACFA Striatin-interacting protein 1 OS=Macaca fascicularis GN=STRIP1 PE=2 SV=1 897 1020 4.0E-23
sp|Q8C079|STRP1_MOUSE Striatin-interacting protein 1 OS=Mus musculus GN=Strip1 PE=1 SV=2 897 1020 4.0E-23
sp|Q5R7S4|STRP1_PONAB Striatin-interacting protein 1 OS=Pongo abelii GN=STRIP1 PE=2 SV=2 897 1020 4.0E-23
sp|Q5VSL9|STRP1_HUMAN Striatin-interacting protein 1 OS=Homo sapiens GN=STRIP1 PE=1 SV=1 897 1020 4.0E-23
sp|Q8C9H6|STRP2_MOUSE Striatin-interacting proteins 2 OS=Mus musculus GN=Strip2 PE=1 SV=1 895 1020 2.0E-22
sp|Q803T2|STRP1_DANRE Striatin-interacting protein 1 homolog OS=Danio rerio GN=strip1 PE=1 SV=1 897 1020 2.0E-22
sp|Q9ULQ0|STRP2_HUMAN Striatin-interacting protein 2 OS=Homo sapiens GN=STRIP2 PE=1 SV=2 895 1020 3.0E-22
sp|P53917|FAR11_YEAST Factor arrest protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR11 PE=1 SV=1 373 813 4.0E-22
sp|O13665|FAR11_SCHPO Factor arrest protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=far11 PE=1 SV=1 874 1035 2.0E-18
sp|Q54IL2|STRP_DICDI Striatin-interacting protein homolog OS=Dictyostelium discoideum GN=fam40 PE=3 SV=1 900 989 9.0E-13
sp|P53917|FAR11_YEAST Factor arrest protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR11 PE=1 SV=1 909 1048 1.0E-09
sp|O13665|FAR11_SCHPO Factor arrest protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=far11 PE=1 SV=1 329 577 9.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1664
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|199
Ophiocordyceps australis map64 (Brazil) OphauB2|4165
Ophiocordyceps camponoti-floridani Ophcf2|04885
Ophiocordyceps camponoti-rufipedis Ophun1|5199 (this protein)
Ophiocordyceps kimflemingae Ophio5|2534
Ophiocordyceps subramaniannii Hirsu2|1410

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5199
MNSLWPSRATAEAPDAPKPTEDVADTGEVAEFRPEPLERPPVPPPPMRPGLIRNAIQPGPPQQQPPPPGQAQGRG
RQQQQQQLQQQQLQQQQQQQLQQQQQLQQQQQPPAPTDSLSLQQLRRIVAEVNRQEPVAYDFVYADTGPHAEEID
EWFVYQFWQWVRLNAAQKAFEWHWNLESGGNNAWDDADNDTRARFVQAAIAGVQSNDAALRSASIGKLVYLVLGR
WADTAVPSLTAVGARSVASASQLQAIKAGVECLASLEGLPVIWEALRNCFEVHWSGDIQQQASPQEAQDELMNLM
TIMYITIQETLNDPDDMSSSYGKLLELNPSLVDFMLTATSKLRWDEQNTMPHTQVSDVSHTERALLNCQIFLLFW
KSILLVFGGTKELEELKRVTSETATDSKESEVITATPLDYHAFRQEITSKYPAYVPPPPLIPLEADYTTLLPPLP
NQPFRSSATQGVVPAPPHAQNGGASILHQPVHIATPAPSPPPSPGVGGKGGKKQNYQTNQNFPFMYPPLDATSNS
AGGKGTAGAYDGVISRRWEGSDIPASILEAGELFSSRVRMTRATRQLWEERERFLKYERGWDVEDDEVDHLSLDE
LTPEERQIIEELKAEDRKKAPPPLEAEIDFGPSPERLSDRSKQRLMAVEKFYKEALPHLQSLVIVLLRPILVNVT
AVVAQQATMMTREMACRVFNGAGQGPHKPSDVAGQMNRAEEPEPSPEEVDAARTREITSKAMTGILVLLLKWLRV
SHVLNYEYFTQLLLDSNYIPLVLKLFAHQDIQKVVDSKMDRIENSFFQFCNLRSKFKDKGESDIDEDEEEAAGPA
EERAAEEEQDTGGDSDDSAAPPPIRRRSSPVQGEKQDETEGAEDAGEESSRPEVDEVGCPVNGQATEPITDFSRR
NFFSLINYLRVMQKICKGKAHRNLLLVQYKSSTILRKSLRIPHKDLQLYTLKLFKNQVPYCGRKWRQSNMRVITS
IYLYCRPELRDEWLAGSDVDADVEAALPLEQALRSLTHWRNVRRYPDEIAPDIRAAMREEQDFFTRELEKLHVNW
AELASDEAGMGADVDHGEGWN*
Coding >Ophun1|5199
ATGAACAGCTTGTGGCCCTCGAGAGCGACGGCCGAGGCGCCTGACGCCCCCAAGCCGACCGAAGACGTGGCAGAT
ACTGGAGAGGTGGCCGAATTCAGGCCCGAGCCGCTCGAGAGACCGCCCGTACCTCCACCGCCGATGCGGCCAGGC
CTCATCCGTAATGCGATTCAGCCCGGTCCTCCGCAGCAACAGCCGCCGCCGCCGGGACAGGCACAAGGCCGGGGC
AGACAGCAGCAGCAGCAGCAGCTTCAGCAACAGCAGCTTCAGCAACAGCAACAGCAACAGCTTCAGCAACAGCAA
CAGCTTCAGCAACAGCAGCAGCCCCCCGCGCCGACCGACTCGCTGTCCCTGCAGCAGCTGCGCCGCATCGTCGCC
GAGGTCAACCGCCAGGAGCCGGTGGCCTACGACTTTGTCTACGCAGACACAGGCCCGCACGCGGAAGAAATCGAC
GAGTGGTTCGTCTATCAATTCTGGCAATGGGTGCGCCTTAATGCGGCGCAAAAGGCTTTCGAGTGGCACTGGAAC
CTCGAGTCAGGCGGCAACAACGCTTGGGACGATGCCGACAACGACACCCGCGCCAGGTTTGTTCAGGCGGCCATT
GCAGGCGTCCAGTCCAATGACGCGGCCCTGCGTTCTGCCTCCATCGGGAAGCTCGTCTACCTCGTTTTGGGCCGA
TGGGCCGATACGGCCGTTCCTAGCTTGACGGCCGTTGGGGCGCGGTCCGTGGCCAGCGCCTCGCAGCTTCAGGCC
ATCAAGGCGGGAGTCGAGTGCCTTGCCTCGCTCGAGGGTCTGCCCGTCATCTGGGAGGCGCTGCGGAATTGCTTC
GAGGTGCATTGGTCTGGCGACATACAGCAGCAGGCCAGCCCGCAGGAGGCTCAAGACGAATTAATGAACCTTATG
ACTATCATGTACATCACCATTCAAGAAACGCTCAACGACCCTGACGACATGTCCTCGTCGTATGGAAAGCTCTTG
GAGCTGAACCCTTCACTCGTCGACTTTATGCTTACAGCTACGTCCAAGCTTCGATGGGACGAGCAAAACACTATG
CCTCATACGCAGGTCAGTGACGTTTCCCATACCGAAAGGGCTTTGCTGAATTGCCAGATTTTTCTCCTCTTTTGG
AAATCCATCTTACTCGTCTTCGGCGGCACCAAGGAGCTCGAAGAACTGAAACGAGTCACAAGCGAGACGGCCACG
GACAGCAAGGAGAGCGAGGTCATCACTGCCACGCCCCTGGATTACCACGCGTTCCGGCAAGAGATCACGTCCAAA
TACCCTGCATACGTCCCTCCGCCGCCCCTCATCCCACTGGAAGCCGACTATACAACTCTTCTACCCCCTTTACCG
AACCAGCCCTTCAGAAGCAGCGCGACACAAGGCGTCGTACCAGCGCCGCCTCACGCGCAGAACGGAGGTGCCTCC
ATCCTGCATCAGCCGGTACACATCGCCACGCCCGCTCCATCTCCGCCGCCATCGCCGGGAGTCGGAGGTAAGGGC
GGCAAGAAGCAGAACTACCAGACGAACCAAAACTTCCCTTTCATGTACCCACCTCTGGACGCCACCAGTAACAGC
GCCGGCGGCAAAGGAACGGCAGGGGCCTATGACGGGGTCATCAGCCGAAGATGGGAGGGAAGTGATATCCCGGCG
TCTATCCTCGAGGCGGGCGAGCTCTTTTCGTCGCGCGTGAGAATGACGCGCGCAACCCGACAGCTGTGGGAAGAG
CGTGAACGCTTTCTCAAGTACGAACGTGGCTGGGACGTGGAAGACGACGAGGTTGATCATCTCAGCTTGGACGAG
CTCACGCCAGAAGAGAGGCAAATCATCGAGGAGCTCAAGGCCGAGGACAGGAAAAAGGCGCCTCCTCCTTTGGAA
GCAGAGATTGACTTTGGTCCGAGTCCGGAGCGGCTCAGTGACAGGAGTAAGCAGAGGCTCATGGCGGTGGAAAAG
TTCTACAAAGAGGCTCTCCCTCATCTGCAATCGCTGGTGATTGTTCTGCTACGCCCGATCCTGGTCAACGTGACG
GCCGTCGTCGCTCAGCAGGCGACCATGATGACGAGGGAAATGGCCTGCAGGGTCTTCAACGGCGCGGGTCAGGGG
CCGCACAAGCCGTCAGACGTGGCAGGACAGATGAATCGCGCGGAAGAGCCCGAGCCGTCGCCAGAGGAGGTCGAC
GCAGCGAGGACGAGGGAGATTACTTCCAAGGCCATGACGGGCATCCTGGTTCTCCTGCTCAAATGGTTGAGAGTC
TCGCACGTTCTCAATTACGAGTATTTTACTCAGCTTCTCCTGGATTCTAACTACATCCCTCTCGTCCTCAAGCTT
TTTGCACACCAGGATATTCAGAAGGTGGTCGACAGTAAGATGGACCGCATAGAAAATAGCTTCTTTCAGTTCTGC
AACTTGCGCTCTAAGTTTAAGGATAAGGGAGAGAGCGATATTGATGAGGACGAGGAAGAGGCCGCGGGCCCGGCA
GAAGAGAGGGCGGCAGAGGAGGAGCAGGACACGGGCGGCGACAGCGACGACAGCGCAGCGCCACCGCCCATCAGG
AGGCGGTCCTCGCCCGTGCAAGGCGAAAAGCAGGACGAAACCGAGGGCGCAGAAGACGCAGGAGAGGAATCATCG
CGGCCCGAGGTGGACGAAGTCGGATGCCCGGTCAACGGCCAGGCGACGGAGCCCATCACGGACTTTTCCAGGCGC
AACTTCTTCTCGCTCATCAACTACCTGCGGGTGATGCAAAAGATCTGCAAGGGCAAGGCGCACCGCAACCTCCTG
CTGGTGCAGTACAAGTCGTCGACGATCCTACGCAAGTCGCTCCGTATACCGCACAAGGACCTGCAGCTGTACACG
CTCAAGCTGTTCAAGAATCAGGTGCCATATTGCGGACGCAAGTGGCGTCAGAGCAACATGCGCGTCATCACGTCC
ATCTATCTCTACTGCCGGCCCGAGCTGCGCGACGAGTGGCTGGCGGGCAGCGACGTGGACGCCGATGTCGAGGCC
GCCCTTCCGCTCGAACAGGCACTGCGCAGCCTCACCCACTGGCGCAACGTCCGCCGCTATCCGGACGAGATTGCG
CCTGATATCCGGGCTGCCATGCGCGAGGAACAGGATTTCTTCACACGGGAGCTTGAGAAGTTGCATGTGAACTGG
GCCGAGTTGGCGAGCGACGAGGCTGGAATGGGAGCGGACGTCGATCACGGCGAGGGCTGGAACTGA
Transcript >Ophun1|5199
ATGAACAGCTTGTGGCCCTCGAGAGCGACGGCCGAGGCGCCTGACGCCCCCAAGCCGACCGAAGACGTGGCAGAT
ACTGGAGAGGTGGCCGAATTCAGGCCCGAGCCGCTCGAGAGACCGCCCGTACCTCCACCGCCGATGCGGCCAGGC
CTCATCCGTAATGCGATTCAGCCCGGTCCTCCGCAGCAACAGCCGCCGCCGCCGGGACAGGCACAAGGCCGGGGC
AGACAGCAGCAGCAGCAGCAGCTTCAGCAACAGCAGCTTCAGCAACAGCAACAGCAACAGCTTCAGCAACAGCAA
CAGCTTCAGCAACAGCAGCAGCCCCCCGCGCCGACCGACTCGCTGTCCCTGCAGCAGCTGCGCCGCATCGTCGCC
GAGGTCAACCGCCAGGAGCCGGTGGCCTACGACTTTGTCTACGCAGACACAGGCCCGCACGCGGAAGAAATCGAC
GAGTGGTTCGTCTATCAATTCTGGCAATGGGTGCGCCTTAATGCGGCGCAAAAGGCTTTCGAGTGGCACTGGAAC
CTCGAGTCAGGCGGCAACAACGCTTGGGACGATGCCGACAACGACACCCGCGCCAGGTTTGTTCAGGCGGCCATT
GCAGGCGTCCAGTCCAATGACGCGGCCCTGCGTTCTGCCTCCATCGGGAAGCTCGTCTACCTCGTTTTGGGCCGA
TGGGCCGATACGGCCGTTCCTAGCTTGACGGCCGTTGGGGCGCGGTCCGTGGCCAGCGCCTCGCAGCTTCAGGCC
ATCAAGGCGGGAGTCGAGTGCCTTGCCTCGCTCGAGGGTCTGCCCGTCATCTGGGAGGCGCTGCGGAATTGCTTC
GAGGTGCATTGGTCTGGCGACATACAGCAGCAGGCCAGCCCGCAGGAGGCTCAAGACGAATTAATGAACCTTATG
ACTATCATGTACATCACCATTCAAGAAACGCTCAACGACCCTGACGACATGTCCTCGTCGTATGGAAAGCTCTTG
GAGCTGAACCCTTCACTCGTCGACTTTATGCTTACAGCTACGTCCAAGCTTCGATGGGACGAGCAAAACACTATG
CCTCATACGCAGGTCAGTGACGTTTCCCATACCGAAAGGGCTTTGCTGAATTGCCAGATTTTTCTCCTCTTTTGG
AAATCCATCTTACTCGTCTTCGGCGGCACCAAGGAGCTCGAAGAACTGAAACGAGTCACAAGCGAGACGGCCACG
GACAGCAAGGAGAGCGAGGTCATCACTGCCACGCCCCTGGATTACCACGCGTTCCGGCAAGAGATCACGTCCAAA
TACCCTGCATACGTCCCTCCGCCGCCCCTCATCCCACTGGAAGCCGACTATACAACTCTTCTACCCCCTTTACCG
AACCAGCCCTTCAGAAGCAGCGCGACACAAGGCGTCGTACCAGCGCCGCCTCACGCGCAGAACGGAGGTGCCTCC
ATCCTGCATCAGCCGGTACACATCGCCACGCCCGCTCCATCTCCGCCGCCATCGCCGGGAGTCGGAGGTAAGGGC
GGCAAGAAGCAGAACTACCAGACGAACCAAAACTTCCCTTTCATGTACCCACCTCTGGACGCCACCAGTAACAGC
GCCGGCGGCAAAGGAACGGCAGGGGCCTATGACGGGGTCATCAGCCGAAGATGGGAGGGAAGTGATATCCCGGCG
TCTATCCTCGAGGCGGGCGAGCTCTTTTCGTCGCGCGTGAGAATGACGCGCGCAACCCGACAGCTGTGGGAAGAG
CGTGAACGCTTTCTCAAGTACGAACGTGGCTGGGACGTGGAAGACGACGAGGTTGATCATCTCAGCTTGGACGAG
CTCACGCCAGAAGAGAGGCAAATCATCGAGGAGCTCAAGGCCGAGGACAGGAAAAAGGCGCCTCCTCCTTTGGAA
GCAGAGATTGACTTTGGTCCGAGTCCGGAGCGGCTCAGTGACAGGAGTAAGCAGAGGCTCATGGCGGTGGAAAAG
TTCTACAAAGAGGCTCTCCCTCATCTGCAATCGCTGGTGATTGTTCTGCTACGCCCGATCCTGGTCAACGTGACG
GCCGTCGTCGCTCAGCAGGCGACCATGATGACGAGGGAAATGGCCTGCAGGGTCTTCAACGGCGCGGGTCAGGGG
CCGCACAAGCCGTCAGACGTGGCAGGACAGATGAATCGCGCGGAAGAGCCCGAGCCGTCGCCAGAGGAGGTCGAC
GCAGCGAGGACGAGGGAGATTACTTCCAAGGCCATGACGGGCATCCTGGTTCTCCTGCTCAAATGGTTGAGAGTC
TCGCACGTTCTCAATTACGAGTATTTTACTCAGCTTCTCCTGGATTCTAACTACATCCCTCTCGTCCTCAAGCTT
TTTGCACACCAGGATATTCAGAAGGTGGTCGACAGTAAGATGGACCGCATAGAAAATAGCTTCTTTCAGTTCTGC
AACTTGCGCTCTAAGTTTAAGGATAAGGGAGAGAGCGATATTGATGAGGACGAGGAAGAGGCCGCGGGCCCGGCA
GAAGAGAGGGCGGCAGAGGAGGAGCAGGACACGGGCGGCGACAGCGACGACAGCGCAGCGCCACCGCCCATCAGG
AGGCGGTCCTCGCCCGTGCAAGGCGAAAAGCAGGACGAAACCGAGGGCGCAGAAGACGCAGGAGAGGAATCATCG
CGGCCCGAGGTGGACGAAGTCGGATGCCCGGTCAACGGCCAGGCGACGGAGCCCATCACGGACTTTTCCAGGCGC
AACTTCTTCTCGCTCATCAACTACCTGCGGGTGATGCAAAAGATCTGCAAGGGCAAGGCGCACCGCAACCTCCTG
CTGGTGCAGTACAAGTCGTCGACGATCCTACGCAAGTCGCTCCGTATACCGCACAAGGACCTGCAGCTGTACACG
CTCAAGCTGTTCAAGAATCAGGTGCCATATTGCGGACGCAAGTGGCGTCAGAGCAACATGCGCGTCATCACGTCC
ATCTATCTCTACTGCCGGCCCGAGCTGCGCGACGAGTGGCTGGCGGGCAGCGACGTGGACGCCGATGTCGAGGCC
GCCCTTCCGCTCGAACAGGCACTGCGCAGCCTCACCCACTGGCGCAACGTCCGCCGCTATCCGGACGAGATTGCG
CCTGATATCCGGGCTGCCATGCGCGAGGAACAGGATTTCTTCACACGGGAGCTTGAGAAGTTGCATGTGAACTGG
GCCGAGTTGGCGAGCGACGAGGCTGGAATGGGAGCGGACGTCGATCACGGCGAGGGCTGGAACTGA
Gene >Ophun1|5199
ATGAACAGCTTGTGGCCCTCGAGAGCGACGGCCGAGGCGCCTGACGCCCCCAAGCCGACCGAAGACGTGGCAGAT
ACTGGAGAGGTGGCCGAATTCAGGCCCGAGCCGCTCGAGAGACCGCCCGTACCTCCACCGCCGATGCGGCCAGGC
CTCATCCGTAATGCGATTCAGCCCGGTCCTCCGCAGCAACAGCCGCCGCCGCCGGGACAGGCACAAGGCCGGGGC
AGACAGCAGCAGCAGCAGCAGCTTCAGCAACAGCAGCTTCAGCAACAGCAACAGCAACAGCTTCAGCAACAGCAA
CAGCTTCAGCAACAGCAGCAGCCCCCCGCGCCGACCGACTCGCTGTCCCTGCAGCAGCTGCGCCGCATCGTCGCC
GAGGTCAACCGCCAGGAGCCGGTGGCCTACGACTTTGTCTACGCAGACACAGGCCCGCACGCGGAAGAAATCGAC
GAGTGGTTCGTCTATCAATTCTGGCAATGGGTGCGCCTTAATGCGGCGCAAAAGGCTTTCGAGTGGCACTGGAAC
CTCGAGTCAGGCGGCAACAACGCTTGGGACGATGCCGACAACGACACCCGCGCCAGGTTTGTTCAGGCGGCCATT
GCAGGCGTCCAGTCCAATGACGCGGCCCTGCGTTCTGCCTCCATCGGGAAGCTCGTCTACCTCGTTTTGGGCCGA
TGGGCCGATACGGCCGTTCCTAGCTTGACGGCCGTTGGGGCGCGGTCCGTGGCCAGCGCCTCGCAGCTTCAGGCC
ATCAAGGCGGGAGTCGAGTGCCTTGCCTCGCTCGAGGGTCTGCCCGTCATCTGGGAGGCGCTGCGGAATTGCTTC
GAGGTGCATTGGTACGTTGTGCTTTCTCCAAAACTTGAAGCGTCTCGTCGCCTGACTCGCGAAACAGGTCTGGCG
ACATACAGCAGCAGGCCAGCCCGCAGGAGGCTCAAGACGAATTAATGAACCTTATGACTATCATGTACATCACCA
TTCAAGAAACGCTCAACGACCCTGACGACATGTCCTCGTCGTATGGAAAGCTCTGTAGGTGATTTCCACCTGGTC
GATCACCCTCAGCTGGCTGACGATGGCTCAGTGGAGCTGAACCCTTCACTCGTCGACTTTATGCTTACAGCTACG
TCCAAGCTTCGATGGGACGAGCAAAACACTATGCCTCATACGCAGGTCAGTGACGTTTCCCATACCGAAAGGGCT
TTGCTGAATTGCCAGATTTTTCTCCTCTTTTGGAAATCCATCTTACTCGTCTTCGGCGGCACCAAGGAGCTCGAA
GAACTGAAACGAGTCACAAGCGAGACGGCCACGGACAGCAAGGAGAGCGAGGTCATCACTGCCACGCCCCTGGAT
TACCACGCGTTCCGGCAAGAGATCACGTCCAAATACCCTGCATACGTCCCTCCGCCGCCCCTCATCCCACTGGAA
GCCGACTATACAACTCTTCTACCCCCTTTACCGAACCAGCCCTTCAGAAGCAGCGCGACACAAGGCGTCGTACCA
GCGCCGCCTCACGCGCAGAACGGAGGTGCCTCCATCCTGCATCAGCCGGTACACATCGCCACGCCCGCTCCATCT
CCGCCGCCATCGCCGGGAGTCGGAGGTAAGGGCGGCAAGAAGCAGAACTACCAGACGAACCAAAACTTCCCTTTC
ATGTACCCACCTCTGGACGCCACCAGTAACAGCGCCGGCGGCAAAGGAACGGCAGGGGCCTATGACGGGGTCATC
AGCCGAAGATGGGAGGGAAGTGATATCCCGGCGTCTATCCTCGAGGCGGGCGAGCTCTTTTCGTCGCGCGTGAGA
ATGACGCGCGCAACCCGACAGCTGTGGGAAGAGCGTGAACGCTTTCTCAAGTACGAACGTGGCTGGGACGTGGAA
GACGACGAGGTTGATCATCTCAGCTTGGACGAGCTCACGCCAGAAGAGAGGCAAATCATCGAGGAGCTCAAGGCC
GAGGACAGGAAAAAGGCGCCTCCTCCTTTGGAAGCAGAGATTGACTTTGGTCCGAGTCCGGAGCGGCTCAGTGAC
AGGAGTAAGCAGAGGCTCATGGCGGTGGAAAAGTTCTACGTGAGTGTCGAAAAGCCGCTGCCCGCATAATTGCTG
ACAGCGTATCCCAGAAAGAGGCTCTCCCTCATCTGCAATCGCTGGTGATTGTTCTGCTACGCCCGATCCTGGTCA
ACGTGACGGCCGTCGTCGCTCAGCAGGCGACCATGATGACGAGGGAAATGGCCTGCAGGGTCTTCAACGGCGCGG
GTCAGGGGCCGCACAAGCCGTCAGACGTGGCAGGACAGATGAATCGCGCGGAAGAGCCCGAGCCGTCGCCAGAGG
AGGTCGACGCAGCGAGGACGAGGGAGATTACTTCCAAGGCCATGACGGGCATCCTGGTTCTCCTGCTCAAATGGT
TGAGAGTCTCGCACGTTCTCAATTACGAGTATTTTACTCAGCTTCTCCTGGATTCTAACTACATCCCTCTCGTCC
TCAAGCTTTTTGCACACCAGGATATTCAGAAGGTGGTCGACAGTAAGATGGACCGCATAGAAAATAGGTCAGTCG
GGAGGAGGCGTCGTGAAAGCAAGGATGTGCCGCTGACAATAGGCAGCTTCTTTCAGTTCTGCAACTTGCGCTCTA
AGTTTAAGGATAAGGGAGAGAGCGATATTGATGAGGACGAGGAAGAGGCCGCGGGCCCGGCAGAAGAGAGGGCGG
CAGAGGAGGAGCAGGACACGGGCGGCGACAGCGACGACAGCGCAGCGCCACCGCCCATCAGGAGGCGGTCCTCGC
CCGTGCAAGGCGAAAAGCAGGACGAAACCGAGGGCGCAGAAGACGCAGGAGAGGAATCATCGCGGCCCGAGGTGG
ACGAAGTCGGATGCCCGGTCAACGGCCAGGCGACGGAGCCCATCACGGACTTTTCCAGGCGCAACTTCTTCTCGC
TCATCAACTACCTGCGGGTGATGCAAAAGATCTGCAAGGGCAAGGCGCACCGCAACCTCCTGCTGGTGCAGTACA
AGTCGTCGACGATCCTACGCAAGTCGCTCCGTATACCGCACAAGGACCTGCAGCTGTACACGCTCAAGCTGTTCA
AGAATCAGGTGCCATATTGCGGACGCAAGTGGCGTCAGAGCAACATGCGCGTCATCACGTCCATCTATCTCTACT
GCCGGCCCGAGCTGCGCGACGAGTGGCTGGCGGGCAGCGACGTGGACGCCGATGTCGAGGCCGCCCTTCCGCTCG
AACAGGCACTGCGCAGCCTCACCCACTGGCGCAACGTCCGCCGCTATCCGGACGAGATTGCGCCTGATATCCGGG
CTGCCATGCGCGAGGAACAGGATTTCTTCACACGGGAGCTTGAGAAGTTGCATGTGAACTGGGCCGAGTTGGCGA
GCGACGAGGCTGGAATGGGAGCGGACGTCGATCACGGCGAGGGCTGGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail