Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5185
Gene name
LocationContig_5:76580..79724
Strand-
Gene length (bp)3144
Transcript length (bp)3039
Coding sequence length (bp)3039
Protein length (aa) 1013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02898 NO_synthase Nitric oxide synthase, oxygenase domain 6.2E-81 111 438
PF00258 Flavodoxin_1 Flavodoxin 6.8E-10 483 617

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 24 626 2.0E-63
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 24 626 1.0E-60
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 26 563 2.0E-60
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 26 758 3.0E-60
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 26 552 6.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 24 626 2.0E-63
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 24 626 1.0E-60
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 26 563 2.0E-60
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 26 758 3.0E-60
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 26 552 6.0E-60
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 27 626 9.0E-60
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 59 626 5.0E-59
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 26 552 1.0E-58
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 27 626 3.0E-58
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 11 583 4.0E-58
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 27 563 6.0E-58
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 28 568 2.0E-57
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 120 555 2.0E-57
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 28 626 3.0E-57
sp|O34453|NOSO_BACSU Nitric oxide synthase oxygenase OS=Bacillus subtilis (strain 168) GN=nos PE=1 SV=2 112 437 8.0E-56
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 59 626 1.0E-55
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 102 552 3.0E-53
sp|Q28969|NOS3_PIG Nitric oxide synthase, endothelial OS=Sus scrofa GN=NOS3 PE=1 SV=4 102 552 1.0E-52
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 43 552 4.0E-52
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 102 552 7.0E-52
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 43 552 3.0E-51
sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 51 572 4.0E-51
sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 102 552 1.0E-50
sp|O61309|NOS_LYMST Nitric oxide synthase OS=Lymnaea stagnalis GN=NOS PE=2 SV=1 102 563 2.0E-49
sp|Q5HEK7|NOSO_STAAC Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain COL) GN=nos PE=3 SV=1 59 428 2.0E-41
sp|P0A092|NOSO_STAAM Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nos PE=3 SV=1 59 428 2.0E-41
sp|P0A093|NOSO_STAAN Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain N315) GN=nos PE=1 SV=1 59 428 2.0E-41
sp|Q6G818|NOSO_STAAS Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MSSA476) GN=nos PE=3 SV=1 59 428 2.0E-41
sp|P0A004|NOSO_STAAU Nitric oxide synthase oxygenase OS=Staphylococcus aureus GN=nos PE=1 SV=1 59 428 2.0E-41
sp|P0A094|NOSO_STAAW Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MW2) GN=nos PE=3 SV=1 59 428 2.0E-41
sp|P79290|NOS2_PIG Nitric oxide synthase, inducible (Fragment) OS=Sus scrofa GN=NOS2 PE=2 SV=1 148 375 3.0E-41
sp|Q6GFE2|NOSO_STAAR Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MRSA252) GN=nos PE=3 SV=1 59 428 4.0E-41
sp|Q9RR97|NOSO_DEIRA Nitric oxide synthase oxygenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nos PE=1 SV=1 112 427 2.0E-36
sp|Q92091|NOS2_ONCMY Nitric oxide synthase, inducible (Fragment) OS=Oncorhynchus mykiss GN=nos2 PE=2 SV=1 311 649 9.0E-18
sp|Q28314|NOS2_CAPHI Nitric oxide synthase, inducible (Fragment) OS=Capra hircus GN=NOS2 PE=2 SV=1 102 210 1.0E-14
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 803 988 6.0E-10
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 483 982 5.0E-09
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 536 907 9.0E-08
sp|Q6CCH0|NDOR1_YARLI NADPH-dependent diflavin oxidoreductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAH18 PE=3 SV=1 472 630 1.0E-06
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 473 893 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006809 nitric oxide biosynthetic process Yes
GO:0010181 FMN binding Yes
GO:0004517 nitric-oxide synthase activity Yes
GO:0032553 ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:2001057 reactive nitrogen species metabolic process No
GO:0043167 ion binding No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046209 nitric oxide metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016491 oxidoreductase activity No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0006807 nitrogen compound metabolic process No
GO:0004497 monooxygenase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5185
MSTASRPSPKEEFKRIQSRYPLLSSTGCTRSFCQSGRMTHTDETRVGDNSRSLETVEAEAVDFLRQAHRDGVIEN
DQVLASRISAALGEIRRTSVTVTFEGREGETSRVVPGIWQQSRQELEHGLRLSWKHARKCIMRSEYSYLKLHDLR
HVKTSREMGQLLVKGMSEAFNGGDIQPSVFVFPPKQANCHGPMIWNQQFLAFAGYQQPDGTILGDPMNTSLTESI
LSLGWKPPKIRTRWDLLPLVTMAEGDEPFLTPVPESLFPLVQIRHPNPEHGPAFDKLGLRWVPAPALSQLGFDIG
GVQYTATPFIGWFMDAEIGVRDLADAFRYNALPSVISGLGLLEPGRELDELPQYERLAMLSRAQLELTLAVHSSF
LLAGVRMSDSLTASAMYSNFDDQHLAQHGFRLPADPYWLAPPQGSIIPIWHRGGSPNYQPKPMICRLKENPVKIW
KRRIGVDAVKNNAIKSGVLVQRSVSPETASIRIFYCSSGTTAQRLATKLEQRLRLIMGQDPELRSVVSAMPLNEM
EPDRLRNGDVVFIVASCAGRGDVPTNGLAMLQRCQNMKTNIASGASFCIFGNGNSSYGQNFNGAAIKLEAALTKV
GLSSALTTFQADTLKEDPPWRQFKTWLSRIEATYGRSSSLDDDLSLSQPVDDSTGLLLSQISPAHVLSIAMTDKG
DIRHLALNVGGLEYSHMSHVDIFVPLHEDKIQELLMAAQLTGDEMAMIGGGQVTTRQLFSLLDPEKPFKSIKWAS
KLELKLTAAEESTLLKMPIGKAIQLLHASDRLCRIRGSALFDFMRALPIRRSRTFSTASSQLYWNTQNMGNVLEL
TLKTHPGGLVTDRFVSHARRGDRIYIRIRNGPGAFLVTDNKPLIAFTIGSGIAPLRGLLQAKSAIAADCHRKTRN
RLSLFLGFKQGDAEIIEESIREARARGLIDMLHLTPSNPAHERAQNQLFNEGVALRIRSKILDEDANVFVCASKE
AADEFADNLGAIIGVSSIRQVLGERWVEEVYVCAADQ*
Coding >Ophun1|5185
ATGTCTACGGCCAGCCGGCCGTCTCCCAAAGAGGAGTTCAAGCGAATCCAAAGCCGCTATCCGCTTCTCTCTTCT
ACGGGATGCACACGATCCTTCTGTCAGAGCGGCCGCATGACCCATACCGACGAGACTCGCGTGGGAGACAACAGC
CGGAGTCTGGAGACGGTCGAGGCAGAAGCCGTCGACTTCCTGCGCCAAGCCCATCGCGATGGTGTCATCGAGAAC
GACCAAGTCTTGGCGAGCCGCATCTCGGCCGCCCTTGGAGAGATCCGCCGTACGTCAGTTACTGTTACATTCGAA
GGGAGAGAAGGGGAGACGAGTCGAGTCGTTCCTGGCATCTGGCAGCAGTCTCGCCAGGAGTTGGAACACGGACTT
CGACTCTCGTGGAAACATGCGAGGAAGTGTATTATGCGGAGCGAGTACAGCTATCTCAAGCTCCACGACCTACGA
CATGTCAAGACCAGCAGAGAGATGGGCCAGCTGCTCGTCAAGGGCATGAGCGAGGCCTTTAACGGGGGAGATATC
CAGCCGAGCGTCTTCGTCTTTCCGCCCAAGCAGGCCAACTGCCACGGCCCCATGATATGGAATCAGCAGTTCCTC
GCCTTTGCCGGCTACCAACAGCCAGACGGCACTATCCTGGGCGACCCCATGAACACCAGCCTCACCGAGTCGATT
CTCTCGCTGGGCTGGAAGCCGCCCAAGATCCGAACCCGTTGGGACCTCCTCCCGCTCGTGACAATGGCAGAAGGA
GATGAGCCCTTCTTAACGCCCGTTCCGGAGAGTCTCTTCCCGCTCGTTCAGATCCGGCATCCCAACCCGGAGCAC
GGGCCGGCCTTTGACAAGCTCGGACTCCGATGGGTTCCGGCTCCGGCCCTCTCGCAACTCGGCTTCGACATTGGC
GGCGTTCAGTACACGGCCACGCCCTTTATCGGCTGGTTCATGGACGCTGAGATCGGAGTCCGAGACCTGGCCGAT
GCATTCCGATACAACGCGTTGCCTTCCGTCATCTCTGGGCTCGGTCTGCTCGAGCCAGGCAGGGAGCTGGACGAG
CTGCCGCAGTATGAGAGGCTGGCGATGCTTTCACGCGCTCAGCTTGAGCTTACCCTGGCTGTTCACTCGTCCTTT
TTGCTTGCTGGCGTCCGGATGAGCGATAGTCTTACCGCCAGCGCCATGTATAGCAACTTTGACGATCAGCATCTG
GCTCAGCATGGCTTCAGACTTCCGGCTGATCCGTACTGGCTGGCTCCTCCTCAGGGGAGCATCATCCCTATATGG
CATCGCGGAGGAAGCCCCAACTATCAGCCCAAGCCCATGATCTGTCGCCTCAAAGAGAACCCAGTCAAGATCTGG
AAGCGACGGATCGGAGTAGACGCCGTCAAGAACAACGCAATCAAGTCCGGCGTTCTCGTTCAGCGATCAGTATCG
CCAGAGACGGCATCTATCCGCATCTTTTACTGCAGTTCTGGCACGACCGCCCAGCGACTGGCCACCAAGCTGGAA
CAGCGGCTCCGTCTCATCATGGGTCAGGACCCGGAGTTGCGGTCCGTTGTCTCAGCTATGCCGCTCAACGAGATG
GAGCCAGACCGTCTTCGAAACGGTGATGTTGTCTTTATCGTGGCCAGCTGTGCGGGAAGAGGCGATGTGCCAACC
AACGGGCTGGCAATGCTGCAGAGATGCCAAAACATGAAGACGAATATCGCCAGCGGCGCGTCCTTTTGCATCTTT
GGAAACGGAAACTCATCGTATGGACAAAACTTCAACGGAGCGGCCATCAAGCTGGAAGCTGCTCTCACCAAAGTC
GGTCTCTCCAGCGCCTTGACAACTTTCCAGGCCGATACACTCAAGGAGGATCCGCCATGGCGACAGTTCAAGACG
TGGTTGTCCAGAATTGAGGCTACATACGGCCGTTCGTCTTCGCTTGACGATGATCTCTCCCTCTCTCAGCCGGTG
GATGACTCGACTGGCCTGCTGCTATCGCAAATCTCGCCGGCTCACGTTCTTTCTATCGCCATGACTGACAAGGGA
GACATTCGACACCTTGCTCTCAACGTTGGCGGGCTCGAATACAGCCACATGAGCCACGTCGACATCTTCGTCCCC
CTTCACGAAGACAAGATCCAAGAGCTACTGATGGCGGCTCAGCTCACTGGCGACGAAATGGCCATGATCGGTGGG
GGACAGGTCACTACCAGGCAGTTGTTCTCTCTTCTCGACCCGGAAAAGCCCTTTAAGTCGATCAAGTGGGCTTCT
AAGCTGGAGCTGAAACTTACAGCTGCCGAGGAGAGCACGCTCCTCAAAATGCCCATCGGGAAAGCCATCCAACTT
CTACATGCATCTGATCGTCTGTGCCGAATCCGCGGCTCTGCTCTCTTCGACTTCATGCGAGCTCTGCCCATCCGA
CGCTCCCGGACCTTTTCAACCGCCTCGTCTCAGCTGTACTGGAACACCCAGAACATGGGCAACGTGCTGGAGCTC
ACGCTCAAGACGCACCCGGGAGGCCTGGTGACGGACCGGTTCGTCTCTCACGCAAGGAGAGGAGATCGAATCTAC
ATCCGGATCCGTAACGGACCAGGCGCTTTTCTCGTTACCGACAACAAGCCGCTCATTGCCTTTACCATCGGCTCC
GGCATCGCTCCGTTAAGGGGCCTGCTACAGGCAAAGTCGGCCATTGCGGCAGACTGCCATCGGAAGACGCGGAAT
CGCCTGTCTCTATTCCTCGGTTTCAAGCAAGGTGACGCTGAGATCATCGAGGAGTCCATCCGCGAGGCGAGAGCA
CGGGGACTCATCGACATGCTACACCTGACGCCGAGCAATCCAGCTCACGAACGGGCACAGAACCAGCTCTTTAAC
GAAGGGGTAGCCTTGCGGATCCGGAGCAAGATTCTAGACGAGGATGCAAATGTCTTTGTCTGTGCTTCCAAGGAG
GCGGCTGACGAGTTTGCTGATAACCTTGGGGCTATTATCGGCGTCAGTTCGATACGGCAGGTTCTTGGTGAGAGA
TGGGTTGAGGAGGTTTACGTGTGCGCTGCCGACCAGTGA
Transcript >Ophun1|5185
ATGTCTACGGCCAGCCGGCCGTCTCCCAAAGAGGAGTTCAAGCGAATCCAAAGCCGCTATCCGCTTCTCTCTTCT
ACGGGATGCACACGATCCTTCTGTCAGAGCGGCCGCATGACCCATACCGACGAGACTCGCGTGGGAGACAACAGC
CGGAGTCTGGAGACGGTCGAGGCAGAAGCCGTCGACTTCCTGCGCCAAGCCCATCGCGATGGTGTCATCGAGAAC
GACCAAGTCTTGGCGAGCCGCATCTCGGCCGCCCTTGGAGAGATCCGCCGTACGTCAGTTACTGTTACATTCGAA
GGGAGAGAAGGGGAGACGAGTCGAGTCGTTCCTGGCATCTGGCAGCAGTCTCGCCAGGAGTTGGAACACGGACTT
CGACTCTCGTGGAAACATGCGAGGAAGTGTATTATGCGGAGCGAGTACAGCTATCTCAAGCTCCACGACCTACGA
CATGTCAAGACCAGCAGAGAGATGGGCCAGCTGCTCGTCAAGGGCATGAGCGAGGCCTTTAACGGGGGAGATATC
CAGCCGAGCGTCTTCGTCTTTCCGCCCAAGCAGGCCAACTGCCACGGCCCCATGATATGGAATCAGCAGTTCCTC
GCCTTTGCCGGCTACCAACAGCCAGACGGCACTATCCTGGGCGACCCCATGAACACCAGCCTCACCGAGTCGATT
CTCTCGCTGGGCTGGAAGCCGCCCAAGATCCGAACCCGTTGGGACCTCCTCCCGCTCGTGACAATGGCAGAAGGA
GATGAGCCCTTCTTAACGCCCGTTCCGGAGAGTCTCTTCCCGCTCGTTCAGATCCGGCATCCCAACCCGGAGCAC
GGGCCGGCCTTTGACAAGCTCGGACTCCGATGGGTTCCGGCTCCGGCCCTCTCGCAACTCGGCTTCGACATTGGC
GGCGTTCAGTACACGGCCACGCCCTTTATCGGCTGGTTCATGGACGCTGAGATCGGAGTCCGAGACCTGGCCGAT
GCATTCCGATACAACGCGTTGCCTTCCGTCATCTCTGGGCTCGGTCTGCTCGAGCCAGGCAGGGAGCTGGACGAG
CTGCCGCAGTATGAGAGGCTGGCGATGCTTTCACGCGCTCAGCTTGAGCTTACCCTGGCTGTTCACTCGTCCTTT
TTGCTTGCTGGCGTCCGGATGAGCGATAGTCTTACCGCCAGCGCCATGTATAGCAACTTTGACGATCAGCATCTG
GCTCAGCATGGCTTCAGACTTCCGGCTGATCCGTACTGGCTGGCTCCTCCTCAGGGGAGCATCATCCCTATATGG
CATCGCGGAGGAAGCCCCAACTATCAGCCCAAGCCCATGATCTGTCGCCTCAAAGAGAACCCAGTCAAGATCTGG
AAGCGACGGATCGGAGTAGACGCCGTCAAGAACAACGCAATCAAGTCCGGCGTTCTCGTTCAGCGATCAGTATCG
CCAGAGACGGCATCTATCCGCATCTTTTACTGCAGTTCTGGCACGACCGCCCAGCGACTGGCCACCAAGCTGGAA
CAGCGGCTCCGTCTCATCATGGGTCAGGACCCGGAGTTGCGGTCCGTTGTCTCAGCTATGCCGCTCAACGAGATG
GAGCCAGACCGTCTTCGAAACGGTGATGTTGTCTTTATCGTGGCCAGCTGTGCGGGAAGAGGCGATGTGCCAACC
AACGGGCTGGCAATGCTGCAGAGATGCCAAAACATGAAGACGAATATCGCCAGCGGCGCGTCCTTTTGCATCTTT
GGAAACGGAAACTCATCGTATGGACAAAACTTCAACGGAGCGGCCATCAAGCTGGAAGCTGCTCTCACCAAAGTC
GGTCTCTCCAGCGCCTTGACAACTTTCCAGGCCGATACACTCAAGGAGGATCCGCCATGGCGACAGTTCAAGACG
TGGTTGTCCAGAATTGAGGCTACATACGGCCGTTCGTCTTCGCTTGACGATGATCTCTCCCTCTCTCAGCCGGTG
GATGACTCGACTGGCCTGCTGCTATCGCAAATCTCGCCGGCTCACGTTCTTTCTATCGCCATGACTGACAAGGGA
GACATTCGACACCTTGCTCTCAACGTTGGCGGGCTCGAATACAGCCACATGAGCCACGTCGACATCTTCGTCCCC
CTTCACGAAGACAAGATCCAAGAGCTACTGATGGCGGCTCAGCTCACTGGCGACGAAATGGCCATGATCGGTGGG
GGACAGGTCACTACCAGGCAGTTGTTCTCTCTTCTCGACCCGGAAAAGCCCTTTAAGTCGATCAAGTGGGCTTCT
AAGCTGGAGCTGAAACTTACAGCTGCCGAGGAGAGCACGCTCCTCAAAATGCCCATCGGGAAAGCCATCCAACTT
CTACATGCATCTGATCGTCTGTGCCGAATCCGCGGCTCTGCTCTCTTCGACTTCATGCGAGCTCTGCCCATCCGA
CGCTCCCGGACCTTTTCAACCGCCTCGTCTCAGCTGTACTGGAACACCCAGAACATGGGCAACGTGCTGGAGCTC
ACGCTCAAGACGCACCCGGGAGGCCTGGTGACGGACCGGTTCGTCTCTCACGCAAGGAGAGGAGATCGAATCTAC
ATCCGGATCCGTAACGGACCAGGCGCTTTTCTCGTTACCGACAACAAGCCGCTCATTGCCTTTACCATCGGCTCC
GGCATCGCTCCGTTAAGGGGCCTGCTACAGGCAAAGTCGGCCATTGCGGCAGACTGCCATCGGAAGACGCGGAAT
CGCCTGTCTCTATTCCTCGGTTTCAAGCAAGGTGACGCTGAGATCATCGAGGAGTCCATCCGCGAGGCGAGAGCA
CGGGGACTCATCGACATGCTACACCTGACGCCGAGCAATCCAGCTCACGAACGGGCACAGAACCAGCTCTTTAAC
GAAGGGGTAGCCTTGCGGATCCGGAGCAAGATTCTAGACGAGGATGCAAATGTCTTTGTCTGTGCTTCCAAGGAG
GCGGCTGACGAGTTTGCTGATAACCTTGGGGCTATTATCGGCGTCAGTTCGATACGGCAGGTTCTTGGTGAGAGA
TGGGTTGAGGAGGTTTACGTGTGCGCTGCCGACCAGTGA
Gene >Ophun1|5185
ATGTCTACGGCCAGCCGGCCGTCTCCCAAAGAGGAGTTCAAGCGAATCCAAAGCCGCTATCCGCTTCTCTCTTCT
ACGGGATGCACACGATCCTTCTGTCAGAGCGGCCGCATGACCCATACCGACGAGACTCGCGTGGGAGACAACAGC
CGGAGTCTGGAGACGGTCGAGGCAGAAGCCGTCGACTTCCTGCGCCAAGCCCATCGCGATGGTGTCATCGAGAAC
GACCAAGTCTTGGCGAGCCGCATCTCGGCCGCCCTTGGAGAGATCCGCCGTACGTCAGTTACTGTTACATTCGAA
GGGAGAGAAGGGGAGACGAGTCGAGTCGTTCCTGGCATCTGGCAGCAGTCTCGCCAGGAGTTGGAACACGGACTT
CGACTCTCGTGGAAACATGCGAGGAAGTGTATTATGCGGAGCGAGTACAGCTATCTCAAGTACGTTGACCCAATC
CATCACTGGAGAGAATTCGACTGACAGAAGCAGGCTCCACGACCTACGACATGTCAAGACCAGCAGAGAGATGGG
CCAGCTGCTCGTCAAGGGCATGAGCGAGGCCTTTAACGGGGGAGATATCCAGCCGAGCGGTAAGAGACACAGATA
ACAAGCCCTCGATGAATCCTCATAGCTGAAAACAACTCAGTCTTCGTCTTTCCGCCCAAGCAGGCCAACTGCCAC
GGCCCCATGATATGGAATCAGCAGTTCCTCGCCTTTGCCGGCTACCAACAGCCAGACGGCACTATCCTGGGCGAC
CCCATGAACACCAGCCTCACCGAGTCGATTCTCTCGCTGGGCTGGAAGCCGCCCAAGATCCGAACCCGTTGGGAC
CTCCTCCCGCTCGTGACAATGGCAGAAGGAGATGAGCCCTTCTTAACGCCCGTTCCGGAGAGTCTCTTCCCGCTC
GTTCAGATCCGGCATCCCAACCCGGAGCACGGGCCGGCCTTTGACAAGCTCGGACTCCGATGGGTTCCGGCTCCG
GCCCTCTCGCAACTCGGCTTCGACATTGGCGGCGTTCAGTACACGGCCACGCCCTTTATCGGCTGGTTCATGGAC
GCTGAGATCGGAGTCCGAGACCTGGCCGATGCATTCCGATACAACGCGTTGCCTTCCGTCATCTCTGGGCTCGGT
CTGCTCGAGCCAGGCAGGGAGCTGGACGAGCTGCCGCAGTATGAGAGGCTGGCGATGCTTTCACGCGCTCAGCTT
GAGCTTACCCTGGCTGTTCACTCGTCCTTTTTGCTTGCTGGCGTCCGGATGAGCGATAGTCTTACCGCCAGCGCC
ATGTATAGCAACTTTGACGATCAGCATCTGGCTCAGCATGGCTTCAGACTTCCGGCTGATCCGTACTGGCTGGCT
CCTCCTCAGGGGAGCATCATCCCTATATGGCATCGCGGAGGAAGCCCCAACTATCAGCCCAAGCCCATGATCTGT
CGCCTCAAAGAGAACCCAGTCAAGATCTGGAAGCGACGGATCGGAGTAGACGCCGTCAAGAACAACGCAATCAAG
TCCGGCGTTCTCGTTCAGCGATCAGTATCGCCAGAGACGGCATCTATCCGCATCTTTTACTGCAGTTCTGGCACG
ACCGCCCAGCGACTGGCCACCAAGCTGGAACAGCGGCTCCGTCTCATCATGGGTCAGGACCCGGAGTTGCGGTCC
GTTGTCTCAGCTATGCCGCTCAACGAGATGGAGCCAGACCGTCTTCGAAACGGTGATGTTGTCTTTATCGTGGCC
AGCTGTGCGGGAAGAGGCGATGTGCCAACCAACGGGCTGGCAATGCTGCAGAGATGCCAAAACATGAAGACGAAT
ATCGCCAGCGGCGCGTCCTTTTGCATCTTTGGAAACGGAAACTCATCGTATGGACAAAACTTCAACGGAGCGGCC
ATCAAGCTGGAAGCTGCTCTCACCAAAGTCGGTCTCTCCAGCGCCTTGACAACTTTCCAGGCCGATACACTCAAG
GAGGATCCGCCATGGCGACAGTTCAAGACGTGGTTGTCCAGAATTGAGGCTACATACGGCCGTTCGTCTTCGCTT
GACGATGATCTCTCCCTCTCTCAGCCGGTGGATGACTCGACTGGCCTGCTGCTATCGCAAATCTCGCCGGCTCAC
GTTCTTTCTATCGCCATGACTGACAAGGGAGACATTCGACACCTTGCTCTCAACGTTGGCGGGCTCGAATACAGC
CACATGAGCCACGTCGACATCTTCGTCCCCCTTCACGAAGACAAGATCCAAGAGCTACTGATGGCGGCTCAGCTC
ACTGGCGACGAAATGGCCATGATCGGTGGGGGACAGGTCACTACCAGGCAGTTGTTCTCTCTTCTCGACCCGGAA
AAGCCCTTTAAGTCGATCAAGTGGGCTTCTAAGCTGGAGCTGAAACTTACAGCTGCCGAGGAGAGCACGCTCCTC
AAAATGCCCATCGGGAAAGCCATCCAACTTCTACATGCATCTGATCGTCTGTGCCGAATCCGCGGCTCTGCTCTC
TTCGACTTCATGCGAGCTCTGCCCATCCGACGCTCCCGGACCTTTTCAACCGCCTCGTCTCAGCTGTACTGGAAC
ACCCAGAACATGGGCAACGTGCTGGAGCTCACGCTCAAGACGCACCCGGGAGGCCTGGTGACGGACCGGTTCGTC
TCTCACGCAAGGAGAGGAGATCGAATCTACATCCGGATCCGTAACGGACCAGGCGCTTTTCTCGTTACCGACAAC
AAGCCGCTCATTGCCTTTACCATCGGCTCCGGCATCGCTCCGTTAAGGGGCCTGCTACAGGCAAAGTCGGCCATT
GCGGCAGACTGCCATCGGAAGACGCGGAATCGCCTGTCTCTATTCCTCGGTTTCAAGCAAGGTGACGCTGAGATC
ATCGAGGAGTCCATCCGCGAGGCGAGAGCACGGGGACTCATCGACATGCTACACCTGACGCCGAGCAATCCAGCT
CACGAACGGGCACAGAACCAGCTCTTTAACGAAGGGGTAGCCTTGCGGATCCGGAGCAAGATTCTAGACGAGGAT
GCAAATGTCTTTGTCTGTGCTTCCAAGGAGGCGGCTGACGAGTTTGCTGATAACCTTGGGGCTATTATCGGCGTC
AGTTCGATACGGCAGGTTCTTGGTGAGAGATGGGTTGAGGAGGTTTACGTGTGCGCTGCCGACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail