Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5184
Gene name
LocationContig_5:74163..75430
Strand+
Gene length (bp)1267
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 5.0E-73 1 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 1 360 6.0E-36
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 1 360 4.0E-21
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 1 361 2.0E-20
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 1 361 2.0E-20
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 1 361 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 1 360 6.0E-36
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 1 360 4.0E-21
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 1 361 2.0E-20
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 1 361 2.0E-20
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 1 361 2.0E-20
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 1 361 8.0E-20
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 1 361 4.0E-19
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 1 358 2.0E-16
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 1 361 3.0E-16
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 1 361 3.0E-15
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 1 361 6.0E-14
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 5 297 1.0E-12
sp|I4AY86|BREPT_ASPVE Brevianamide F reverse prenyltransferase OS=Aspergillus versicolor GN=brePT PE=1 SV=1 1 360 1.0E-11
sp|A1DA66|FTMH_NEOFI 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT2 PE=3 SV=1 1 284 2.0E-10
sp|Q4WAX1|FTMH_ASPFU 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT2 PE=3 SV=1 1 284 2.0E-08
sp|B9WZX7|FTMH_ASPFM 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata GN=ftmPT2 PE=1 SV=1 1 284 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5184
MVQGAGYPVEKQYEALLLHYHWMVPSMGPPPSPEGTVAWPSLVNESGRPIEFSWRWNVRGKKPIIRYTIEGKDQF
TGTVADPLNQDASRKLLYGLMRSFPGVDLTWTNHFLSTLFQHDDSKYIQDHDTKGTRTSSLLVAAELNPDRVAFK
TYLVPQVPGLRPVPISFYKDAIAQVCPVSGACSALYDFLDGPCGQSFPTFFLGLDAAAPSESRLKVYLYSPHCSF
KIIRQAMTLDGRRLVPAESIQELRSLVYAIAGVQPEFPEDREFPLANPEFSFRKAVPHPPCCFYFDIAPGRDLPN
VKMFFSMSSFGRDDLSLARVITSWMDEHGKGGYGQSYLSVLECLAPRRRLDEGKGVHSWLGPQ*
Coding >Ophun1|5184
ATGGTGCAAGGAGCGGGATATCCCGTCGAGAAGCAATATGAAGCTCTGCTGCTTCACTATCATTGGATGGTCCCA
TCAATGGGTCCGCCGCCATCCCCCGAAGGTACGGTCGCTTGGCCTTCTCTCGTCAATGAGTCGGGCCGGCCGATA
GAGTTCTCGTGGCGCTGGAACGTGCGCGGCAAGAAACCCATCATTCGCTACACTATCGAGGGCAAGGACCAGTTT
ACGGGCACCGTCGCGGATCCGTTGAACCAGGATGCCTCACGCAAGCTTCTATACGGCCTTATGAGGTCTTTTCCG
GGAGTTGACCTCACTTGGACCAACCACTTCCTCTCAACCCTCTTCCAGCATGACGATTCAAAGTACATCCAGGAC
CACGACACCAAAGGCACGAGGACCTCGAGCTTGCTCGTGGCAGCAGAGTTGAATCCAGACCGTGTGGCCTTCAAA
ACGTACCTCGTTCCTCAAGTCCCCGGTCTGCGTCCGGTCCCCATCAGCTTTTACAAGGATGCCATTGCCCAAGTC
TGCCCCGTATCTGGCGCCTGCAGTGCACTATACGACTTTCTCGATGGTCCCTGTGGCCAATCCTTTCCCACATTT
TTTCTTGGACTCGACGCTGCAGCGCCATCAGAATCCCGGCTCAAGGTCTATCTTTACTCGCCCCATTGCAGCTTC
AAAATCATAAGGCAGGCCATGACACTAGACGGGCGAAGACTCGTTCCCGCGGAGTCTATCCAGGAACTGCGAAGC
CTGGTCTATGCTATAGCCGGCGTACAGCCCGAGTTTCCTGAGGACCGCGAGTTCCCTTTGGCAAATCCTGAGTTT
TCCTTTAGAAAGGCAGTACCACACCCTCCATGTTGCTTTTACTTTGACATTGCCCCGGGCCGTGATCTTCCCAAC
GTGAAGATGTTCTTTAGCATGTCAAGCTTTGGCAGAGACGACTTAAGCTTGGCACGGGTCATCACGAGCTGGATG
GACGAGCACGGCAAGGGTGGCTATGGCCAGAGCTATCTGTCGGTGCTCGAGTGTCTTGCGCCGCGTCGACGGCTG
GATGAGGGCAAGGGGGTGCATTCTTGGCTTGGGCCGCAGTGA
Transcript >Ophun1|5184
ATGGTGCAAGGAGCGGGATATCCCGTCGAGAAGCAATATGAAGCTCTGCTGCTTCACTATCATTGGATGGTCCCA
TCAATGGGTCCGCCGCCATCCCCCGAAGGTACGGTCGCTTGGCCTTCTCTCGTCAATGAGTCGGGCCGGCCGATA
GAGTTCTCGTGGCGCTGGAACGTGCGCGGCAAGAAACCCATCATTCGCTACACTATCGAGGGCAAGGACCAGTTT
ACGGGCACCGTCGCGGATCCGTTGAACCAGGATGCCTCACGCAAGCTTCTATACGGCCTTATGAGGTCTTTTCCG
GGAGTTGACCTCACTTGGACCAACCACTTCCTCTCAACCCTCTTCCAGCATGACGATTCAAAGTACATCCAGGAC
CACGACACCAAAGGCACGAGGACCTCGAGCTTGCTCGTGGCAGCAGAGTTGAATCCAGACCGTGTGGCCTTCAAA
ACGTACCTCGTTCCTCAAGTCCCCGGTCTGCGTCCGGTCCCCATCAGCTTTTACAAGGATGCCATTGCCCAAGTC
TGCCCCGTATCTGGCGCCTGCAGTGCACTATACGACTTTCTCGATGGTCCCTGTGGCCAATCCTTTCCCACATTT
TTTCTTGGACTCGACGCTGCAGCGCCATCAGAATCCCGGCTCAAGGTCTATCTTTACTCGCCCCATTGCAGCTTC
AAAATCATAAGGCAGGCCATGACACTAGACGGGCGAAGACTCGTTCCCGCGGAGTCTATCCAGGAACTGCGAAGC
CTGGTCTATGCTATAGCCGGCGTACAGCCCGAGTTTCCTGAGGACCGCGAGTTCCCTTTGGCAAATCCTGAGTTT
TCCTTTAGAAAGGCAGTACCACACCCTCCATGTTGCTTTTACTTTGACATTGCCCCGGGCCGTGATCTTCCCAAC
GTGAAGATGTTCTTTAGCATGTCAAGCTTTGGCAGAGACGACTTAAGCTTGGCACGGGTCATCACGAGCTGGATG
GACGAGCACGGCAAGGGTGGCTATGGCCAGAGCTATCTGTCGGTGCTCGAGTGTCTTGCGCCGCGTCGACGGCTG
GATGAGGGCAAGGGGGTGCATTCTTGGCTTGGGCCGCAGTGA
Gene >Ophun1|5184
ATGGTGCAAGGAGCGGGATATCCCGTCGAGAAGCAATATGAAGCTCTGCTGCTTCACTATCATTGGATGGTAAGC
GGCCATGGTCAAGGTTCAGTGTCGTGCCCTGAGCTCTGCTCACACAACTCCAGGTCCCATCAATGGGTCCGCCGC
CATCCCCCGAAGGTACGGTCGCTTGGCCTTCTCTCGTCAATGAGTCGGGCCGGCCGATAGAGTTCTCGTGGCGCT
GGAACGTGCGCGGCAAGAAACCCATCATTCGCTACACTATCGAGGGCAAGGACCAGTTTACGGGCACCGTCGCGG
ATCCGTTGAACCAGGATGCCTCACGCAAGCTTCTATACGGCCTTATGAGGTCTTTTCCGGGAGTTGACCTCACTT
GGACCAACCACTTCCTCTCAACCCTCTTCCAGCATGACGATTCAAAGTACATCCAGGACCACGACACCAAAGGCA
CGAGGACCTCGAGCTTGCTCGTGGCAGCAGAGTTGAATCCAGACCGTGTGGCCTTCAAAACGTACCTCGTTCCTC
AAGTCCCCGGTCTGCGTCCGGTCCCCATCAGCTTTTACAAGGATGCCATTGCCCAAGTCTGCCCCGTATCTGGCG
CCTGCAGTGCACTATACGACTTTCTCGATGGTCCCTGTGGCCAATCCTTTCCCACATTGTGAGTCCTTCTTGGCT
TTGCTCTTCTCTGACACGGGCTGTTAATTCTGGTGGTAGTTTTCTTGGACTCGACGCTGCAGCGCCATCAGAATC
CCGGCTCAAGGTCTATCTTTACTCGCCCCATTGCAGCTTCAAAATCATAAGGCAGGCCATGACACTAGACGGGCG
AAGACTCGTTCCCGCGGAGTCTATCCAGGAACTGCGAAGCCTGGTCTATGCTATAGCCGGCGTACAGCCCGAGTT
TCCTGAGGACCGCGAGTTCCCTTTGGCAAATCCTGAGTTTTCCTTTAGAAAGGCAGTACCACACCCTCCATGTTG
CTTTTACTTTGACATTGCCCCGGGCCGTGATCTTCCCAACGTGAAGATGTTCTTTAGCATGTCAAGCTTTGGCAG
AGACGACTTAAGCTTGGCACGGGTCATCACGAGCTGGATGGACGAGCACGGCAAGGGTGGCTATGGCCAGAGCTA
TCTGTCGGTGCTCGAGTGTCTTGCGCCGCGTCGACGGCTGGATGAGGGCAAGGGGGTGCATTCTTGGCTTGGGTG
CTTGATTGCTGAGGACGGACAGCTGGATGTGGCTTCATATATTACACCTGACCGCAGGCCGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail