Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5181
Gene name
LocationContig_5:67480..69978
Strand+
Gene length (bp)2498
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 8.3E-23 220 330
PF14765 PS-DH Polyketide synthase dehydratase 6.8E-09 330 470
PF00698 Acyl_transf_1 Acyl transferase domain 6.5E-15 1 106
PF00698 Acyl_transf_1 Acyl transferase domain 3.2E-08 106 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 202 9.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 215 8.0E-18
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 227 2.0E-17
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 30 205 2.0E-16
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 30 205 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 202 9.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 215 8.0E-18
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 227 2.0E-17
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 30 205 2.0E-16
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 30 205 4.0E-16
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 201 5.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 202 2.0E-12
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 218 429 6.0E-11
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 201 9.0E-11
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 201 1.0E-10
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 205 6.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 206 7.0E-09
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 206 7.0E-08
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 62 117 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5181
MGVDLLPLYPVFAQSIQRSAENMKDLEAKWDLIEELSKPESSSRLAEAEFAQSCCTALHCCTALQLALVDLLESW
NVKPDVVCGHSSGEIAAAYASGALSALDAFVTLSGDVDALDEIKETLTVVGVFNRKLAVSVAYHSLHLKPVENDY
LTAISSIVTREHKKAVRLVSSVIGREMSGTELGGKYWTRNLLCPVRFSDALKEAVALVGGGTLTLAQDSIAAEPS
WRKYIRLSETPWLRGHVVNGNVVLAGACFVTAVVEAVRQKQVLAGGQNSEGVVHFRDVIFEKPLLVQDDDIGTEV
VTLLRPYSSVQKESSKWLEFRIFSLSHGNDRLRALGLDYTGCFNAMVSASARPWESSCVVRVQDVASTVPSGYQQ
PHSLHPTTLKGCLQTSFVGYQAADSMHQAHVLAFIDELVVNIGTVLQPGQQLSVATKTRPYGLRQIASDLVAVSD
EDDSTVLIRATGVKTCPVEGAEDISKSGQGEDEPRCYQIDWHLDPLLASTESLVRQCSKDLTAPVHAQLSRAESP
SEPKPCPSEEKMIALGITGEVLVRFGRCLPDIFTRQPDSIALLLENNMLGRIYTKDENVKRCNV*
Coding >Ophun1|5181
ATGGGCGTAGACCTCTTACCCCTATACCCCGTCTTCGCCCAATCAATCCAGCGCTCAGCAGAAAATATGAAAGAC
CTGGAAGCAAAATGGGATCTCATCGAGGAGCTGAGCAAGCCAGAGTCAAGTTCGCGACTTGCCGAAGCCGAATTC
GCTCAGTCTTGCTGCACGGCCCTTCATTGCTGCACGGCCCTTCAACTCGCGCTGGTCGACCTGCTCGAAAGCTGG
AACGTGAAGCCAGATGTCGTCTGCGGACACTCAAGCGGCGAGATAGCTGCGGCTTATGCCTCGGGTGCTTTGTCG
GCTTTAGATGCGTTCGTGACTCTTTCAGGAGACGTGGATGCCCTGGACGAGATCAAGGAGACGTTGACCGTGGTC
GGCGTGTTTAACCGGAAACTAGCTGTCAGCGTTGCCTATCACTCACTACATCTGAAGCCAGTAGAAAACGACTAT
CTCACCGCCATCAGCAGCATCGTCACACGGGAGCACAAGAAAGCCGTCCGGCTCGTTTCCTCCGTCATAGGCCGC
GAGATGTCTGGAACGGAGCTCGGCGGAAAGTACTGGACACGTAATCTTCTTTGTCCCGTTCGCTTCTCCGACGCG
TTGAAGGAGGCAGTGGCTTTGGTTGGGGGCGGGACTTTGACCCTGGCGCAGGATAGCATCGCAGCTGAGCCCTCG
TGGCGCAAGTACATCCGTCTAAGCGAGACGCCCTGGCTCAGAGGCCATGTTGTCAACGGAAATGTTGTTCTCGCG
GGGGCGTGTTTCGTTACGGCTGTTGTCGAGGCTGTTAGGCAGAAGCAGGTGCTTGCGGGGGGGCAGAACTCGGAG
GGTGTAGTTCACTTCCGCGACGTTATCTTTGAGAAGCCGCTGCTTGTGCAGGACGATGATATCGGTACCGAGGTT
GTTACGCTTCTTCGGCCGTACTCTTCTGTGCAAAAGGAGAGCTCCAAGTGGCTCGAGTTTCGAATCTTTAGCCTT
TCTCATGGCAACGACCGGCTCCGGGCGCTGGGTCTCGACTACACTGGCTGTTTCAACGCCATGGTCTCTGCTTCA
GCTCGGCCGTGGGAGTCTAGCTGTGTGGTTCGAGTACAGGATGTGGCGTCGACAGTGCCCTCTGGTTACCAGCAG
CCGCACAGCCTGCATCCCACCACTCTCAAAGGCTGTCTTCAGACAAGTTTCGTTGGATACCAGGCAGCGGATAGC
ATGCATCAAGCTCACGTTCTGGCTTTCATCGATGAGCTGGTAGTGAATATTGGGACGGTCCTTCAGCCGGGGCAG
CAGCTTTCTGTTGCGACAAAGACAAGGCCGTACGGACTTCGACAGATAGCTTCGGATCTCGTGGCCGTCAGCGAT
GAGGATGATTCGACAGTTTTGATCCGGGCGACTGGCGTCAAGACTTGTCCTGTTGAAGGCGCGGAAGATATCTCC
AAGTCTGGGCAAGGAGAGGACGAGCCTCGATGCTACCAGATAGACTGGCATCTCGATCCGCTGCTAGCTTCAACG
GAGAGTCTCGTGCGCCAGTGCAGCAAGGATCTCACCGCTCCCGTTCATGCGCAGTTGTCAAGAGCCGAGTCTCCA
TCCGAGCCTAAACCCTGTCCTTCCGAGGAAAAGATGATCGCTCTCGGAATCACAGGAGAAGTCCTCGTCCGCTTC
GGCCGCTGCCTGCCCGACATTTTCACCCGCCAACCAGACTCAATAGCCCTCCTCCTCGAAAACAACATGCTAGGC
CGCATCTACACAAAAGACGAAAACGTCAAGAGATGCAACGTCTAG
Transcript >Ophun1|5181
ATGGGCGTAGACCTCTTACCCCTATACCCCGTCTTCGCCCAATCAATCCAGCGCTCAGCAGAAAATATGAAAGAC
CTGGAAGCAAAATGGGATCTCATCGAGGAGCTGAGCAAGCCAGAGTCAAGTTCGCGACTTGCCGAAGCCGAATTC
GCTCAGTCTTGCTGCACGGCCCTTCATTGCTGCACGGCCCTTCAACTCGCGCTGGTCGACCTGCTCGAAAGCTGG
AACGTGAAGCCAGATGTCGTCTGCGGACACTCAAGCGGCGAGATAGCTGCGGCTTATGCCTCGGGTGCTTTGTCG
GCTTTAGATGCGTTCGTGACTCTTTCAGGAGACGTGGATGCCCTGGACGAGATCAAGGAGACGTTGACCGTGGTC
GGCGTGTTTAACCGGAAACTAGCTGTCAGCGTTGCCTATCACTCACTACATCTGAAGCCAGTAGAAAACGACTAT
CTCACCGCCATCAGCAGCATCGTCACACGGGAGCACAAGAAAGCCGTCCGGCTCGTTTCCTCCGTCATAGGCCGC
GAGATGTCTGGAACGGAGCTCGGCGGAAAGTACTGGACACGTAATCTTCTTTGTCCCGTTCGCTTCTCCGACGCG
TTGAAGGAGGCAGTGGCTTTGGTTGGGGGCGGGACTTTGACCCTGGCGCAGGATAGCATCGCAGCTGAGCCCTCG
TGGCGCAAGTACATCCGTCTAAGCGAGACGCCCTGGCTCAGAGGCCATGTTGTCAACGGAAATGTTGTTCTCGCG
GGGGCGTGTTTCGTTACGGCTGTTGTCGAGGCTGTTAGGCAGAAGCAGGTGCTTGCGGGGGGGCAGAACTCGGAG
GGTGTAGTTCACTTCCGCGACGTTATCTTTGAGAAGCCGCTGCTTGTGCAGGACGATGATATCGGTACCGAGGTT
GTTACGCTTCTTCGGCCGTACTCTTCTGTGCAAAAGGAGAGCTCCAAGTGGCTCGAGTTTCGAATCTTTAGCCTT
TCTCATGGCAACGACCGGCTCCGGGCGCTGGGTCTCGACTACACTGGCTGTTTCAACGCCATGGTCTCTGCTTCA
GCTCGGCCGTGGGAGTCTAGCTGTGTGGTTCGAGTACAGGATGTGGCGTCGACAGTGCCCTCTGGTTACCAGCAG
CCGCACAGCCTGCATCCCACCACTCTCAAAGGCTGTCTTCAGACAAGTTTCGTTGGATACCAGGCAGCGGATAGC
ATGCATCAAGCTCACGTTCTGGCTTTCATCGATGAGCTGGTAGTGAATATTGGGACGGTCCTTCAGCCGGGGCAG
CAGCTTTCTGTTGCGACAAAGACAAGGCCGTACGGACTTCGACAGATAGCTTCGGATCTCGTGGCCGTCAGCGAT
GAGGATGATTCGACAGTTTTGATCCGGGCGACTGGCGTCAAGACTTGTCCTGTTGAAGGCGCGGAAGATATCTCC
AAGTCTGGGCAAGGAGAGGACGAGCCTCGATGCTACCAGATAGACTGGCATCTCGATCCGCTGCTAGCTTCAACG
GAGAGTCTCGTGCGCCAGTGCAGCAAGGATCTCACCGCTCCCGTTCATGCGCAGTTGTCAAGAGCCGAGTCTCCA
TCCGAGCCTAAACCCTGTCCTTCCGAGGAAAAGATGATCGCTCTCGGAATCACAGGAGAAGTCCTCGTCCGCTTC
GGCCGCTGCCTGCCCGACATTTTCACCCGCCAACCAGACTCAATAGCCCTCCTCCTCGAAAACAACATGCTAGGC
CGCATCTACACAAAAGACGAAAACGTCAAGAGATGCAACGTCTAG
Gene >Ophun1|5181
ATGGGCGTAGACCTCTTACCCCTATACCCCGTCTTCGCCCAATCAATCCAGCGCTCAGCAGAAAATATGAAAGAC
CTGGAAGCAAAATGGGATCTCATCGAGGAGCTGAGCAAGCCAGAGTCAAGTTCGCGACTTGCCGAAGCCGAATTC
GCTCAGTCTTGCTGCACGGCCCTTCATTGCTGCACGGCCCTTCAACTCGCGCTGGTCGACCTGCTCGAAAGCTGG
AACGTGAAGCCAGATGTCGTCTGCGGACACTCAAGCGGCGAGATAGCTGCGGCTTATGCCTCGGGTGCTTTGTCG
GCTTTAGATGCGTTGTGAGCGGCGTACTTTCGGGGGAGGGCGGCTTCGAGTCTGCGGGAGAAGGCGCCGGAGCTG
AGAGGCGGGATGCTGGCTGTTGGGTTGGCGGAGGAGGAGGTCAGGGGGTATCTTGCTTATGGGGATGCTGTTGGA
GCTGCTTGCGTTAACAGTCCTCAAAGCGTGACTCTTTCAGGAGACGTGGATGCCCTGGACGAGATCAAGGAGACG
TTGACCGTGGTCGGCGTGTTTAACCGGAAACTAGCTGTCAGCGTTGCCTATCACTCACTACATCTGAAGCCAGTA
GAAAACGACTATCTCACCGCCATCAGCAGCATCGTCACACGGGAGCACAAGAAAGCCGTCCGGCTCGTTTCCTCC
GTCATAGGCCGCGAGATGTCTGGAACGGAGCTCGGCGGAAAGTACTGGACACGTAATCTTCTTTGTCCCGTTCGC
TTCTCCGACGCGTTGAAGGAGGCAGTGGCTTTGGTTGGGGGCGGGACTTTGACGTTGGTTGTTGAGGTTGGTCCT
CGGGCGGCTCTCAAGGCGCCGATTACGCAGACGCTTAAAGTCATGATGGCTGTGGACTCGACGCATTATCTCTCC
TGTTTAACTAAGAAGGAAGATGACGACGAGGCGATTCTGTCGTTTTCTGGCACAGTTTTCGCTCTCGGTGTTTCA
GTTGCCCTCAACCAAGTCAACAACCCCGACGGAAAACTAAAGACAAGCGTCCTAGCTAACCTCCTATCCTACAAC
TAGCATCACAACCACGTCCACTGAAACGAATCCCGTCGAAGCCAAAACTACCGCTTACGCCCCTTCCCCCGACAC
GATCTCCTCGGCAGCCTGGCGCAGGATAGCATCGCAGCTGAGCCCTCGTGGCGCAAGTACATCCGTCTAAGCGAG
ACGCCCTGGCTCAGAGGCCATGTTGTCAACGGAAATGTTGTTCTCGCGGGGGCGTGTTTCGTTACGGCTGTTGTC
GAGGCTGTTAGGCAGAAGCAGGTGCTTGCGGGGGGGCAGAACTCGGAGGGTGTAGTTCACTTCCGCGACGTTATC
TTTGAGAAGCCGCTGCTTGTGCAGGACGATGATATCGGTACCGAGGTTGTTACGCTTCTTCGGCCGTACTCTTCT
GTGCAAAAGGAGAGCTCCAAGTGGCTCGAGTTTCGAATCTTTAGCCTTTCTCATGGCAACGAGTCTACAGCTCAC
TGCCGTGGTCAAGCCGCAAGCTGCTCCTACATATCGACATGGCGGAGAGCTCATCGGTTGCTTCCTGAACTCGGC
TCGAGGTTGACAAGCTATACAGCCGGCTCCGGGCGCTGGGTCTCGACTACACTGGCTGTTTCAACGCCATGGTCT
CTGCTTCAGCTCGGCCGTGGGAGTCTAGCTGTGTGGTTCGAGTACAGGATGTGGCGTCGACAGTGCCCTCTGGTT
ACCAGCAGCCGCACAGCCTGCATCCCACCACTCTCAAAGGCTGTCTTCAGACAAGTTTCGTTGGATACCAGGCAG
CGGATAGCATGCATCAAGCTCACGTTCTGGCTTTCATCGATGAGCTGGTAGTGAATATTGGGACGGTCCTTCAGC
CGGGGCAGCAGCTTTCTGTTGCGACAAAGACAAGGCCGTACGGACTTCGACAGATAGCTTCGGATCTCGTGGCCG
TCAGCGATGAGGATGATTCGACAGTTTTGATCCGGGCGACTGGCGTCAAGACTTGTCCTGTTGAAGGCGCGGAAG
ATATCTCCAAGTCTGGGCAAGGAGAGGACGAGCCTCGATGCTACCAGATAGACTGGCATCTCGATCCGCTGCTAG
CTTCAACGGAGAGTCTCGTGCGCCAGTGCAGCAAGGATCTCACCGCTCCCGTTCATGCGCAGTTGTCAAGAGCCG
AGGTAGATTCATTCAGTCGGACCATCTTGCGGCAGACTCTTGCCCGTCTCACTGCGGAAGACGAAGCAGCAATAT
CAAGACACTTTCAGAACTATCACCAATGGATGCTTACAGTCGACCAGTCTCCATCCGAGCCTAAACCCTGTCCTT
CCGAGGAAAAGATGATCGCTCTCGGAATCACAGGAGAAGTCCTCGTCCGCTTCGGCCGCTGCCTGCCCGACATTT
TCACCCGCCAACCAGACTCAATAGCCCTCCTCCTCGAAAACAACATGCTAGGCCGCATCTACACAAAAGACGAAA
ACGTCAAGAGATGCAACGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail