Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|518
Gene name
LocationContig_1150:1150..3714
Strand-
Gene length (bp)2564
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 7.1E-40 162 426
PF01483 P_proprotein Proprotein convertase P-domain 6.8E-26 500 586

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 4 596 0.0E+00
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 39 732 0.0E+00
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 1 716 1.0E-178
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 10 697 3.0E-175
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 129 757 3.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 4 596 0.0E+00
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 39 732 0.0E+00
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 1 716 1.0E-178
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 10 697 3.0E-175
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 129 757 3.0E-157
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 131 626 9.0E-122
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 131 596 1.0E-121
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 131 590 5.0E-121
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 131 602 1.0E-120
sp|Q62849|PCSK7_RAT Proprotein convertase subtilisin/kexin type 7 OS=Rattus norvegicus GN=Pcsk7 PE=1 SV=1 126 588 7.0E-120
sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 126 593 8.0E-120
sp|P29119|FURI1_XENLA Furin-1 OS=Xenopus laevis GN=furin PE=2 SV=1 59 590 5.0E-119
sp|Q61139|PCSK7_MOUSE Proprotein convertase subtilisin/kexin type 7 OS=Mus musculus GN=Pcsk7 PE=2 SV=2 126 588 1.0E-118
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 131 693 9.0E-114
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 131 595 5.0E-110
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 25 639 1.0E-109
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 131 565 1.0E-109
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 25 588 4.0E-109
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 25 588 8.0E-109
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 130 570 2.0E-108
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 130 570 1.0E-107
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 25 631 1.0E-106
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 25 631 1.0E-106
sp|P21661|NEC2_MOUSE Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1 36 588 7.0E-105
sp|Q5REC2|NEC2_PONAB Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1 36 588 1.0E-104
sp|P28841|NEC2_RAT Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 36 588 1.0E-104
sp|P16519|NEC2_HUMAN Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2 36 588 1.0E-104
sp|Q03333|NEC2_PIG Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1 36 588 1.0E-103
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 33 590 2.0E-103
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 25 590 4.0E-103
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 36 588 7.0E-103
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 119 590 8.0E-103
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 127 590 4.0E-102
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 16 588 6.0E-101
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 16 603 6.0E-100
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 129 591 8.0E-100
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 129 591 8.0E-100
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 129 591 1.0E-99
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 122 590 1.0E-84
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 128 460 3.0E-84
sp|P23916|PRCA_ANAVT Calcium-dependent protease OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=prcA PE=1 SV=3 134 572 1.0E-32
sp|Q59149|PRCA_NOSS1 Calcium-dependent protease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prcA PE=3 SV=2 134 572 8.0E-32
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 130 525 2.0E-12
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 500 601 1.0E-09
sp|Q00139|VG47_ICHVA Subtilisin-like protease OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF47 PE=3 SV=2 263 565 1.0E-09
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 130 531 2.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 162 397 9.0E-07
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 149 443 4.0E-06
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 149 443 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0017171 serine hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0008233 peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 675 697 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|518
MAFRDYDLFDYYVVHLAESASPEEIASELGMRLDGRHSLPHHYVLRTSKSSEDQLQQRLTKRKLMKRDGQEDHVV
RHVLLARKQEPRMRLHKRIIPPGPAAALRSRAFKLPLDTATVKKQQDVMGTLDIHDPMFEEQWHLLNTRQPGHDI
NVTGLWLEGITGKDATVAIVDDGLDMSSDDLKNNYFAAGSWDFNDKGAEPRPRLSDDKHGTRCAGEVAAARNDVC
GVGAAYDARVAGIRILSKPISDADEADAMVYKNQENQIYSCSWGPRDDGRSMEAPGILIQRAILHGIQEGRGGLG
SIFVFASGNGAASDDNCNFDGYTNSIYSITIGAIDRAGHHPYYSELCSAQLVVTYSSGDGDSIHTTDVGTNQCTS
SHGGTSAAAPLAAGIFALVMQVRPDLGWRDVQYLAMETAQPIADQPESWQTTSIGKKYSHYFGYGKIDSYALVER
AKTWTKVKPQAWFFSPWIHVKTAIPEGGDGLTAHFEVTSDMIKKANLERVEHVTITMNVNHTRRGDLSVDLVSPQ
NVVSHIATARTHDSHNGGYVDWTFMTVVHWGESGIGNWSLVVHDTKENKHRGTFVDWRMKLWGEAIDAGAAHHLP
MPETTDDDDHDKTVSSVAGPVATSSGRPGQKPPPQPTMTALPSDHPERPTKPGSAQLSPSASVVPSPAAKAGPYW
IYGAFCLIIVFCIGLGAYLWIARRRRLRNKARDSYEFELIDEEETEAINGLEKDAAGGRRGGRRTRGGELYDAFA
GNSDDDDDDDEDGTREVREYRDGSQDRLTPSDEAEQYVVGEESDDDDDAEAVSPKDSKLLGGRAP*
Coding >Ophun1|518
ATGGCCTTTCGAGACTATGATCTCTTCGACTATTATGTCGTTCACCTCGCCGAGTCCGCTTCTCCGGAAGAGATC
GCTTCGGAGCTGGGTATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTCATGAAGCGAGATGGTCAAGAGGATCACGTCGTT
CGTCACGTCTTGCTCGCACGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCTGGTCCGGCT
GCTGCCCTGCGATCCCGCGCCTTCAAGTTGCCGCTCGACACGGCGACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCGACATTCACGACCCCATGTTTGAGGAGCAATGGCATCTGCTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGCCTGTGGCTCGAGGGCATCACGGGCAAGGATGCCACAGTGGCCATCGTCGACGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAACTACTTCGCCGCCGGCTCCTGGGACTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGTCTGTCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGAAACGACGTCTGC
GGCGTCGGAGCTGCCTACGATGCCCGCGTCGCCGGCATCCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCCGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGGCCCCGCGACGATGGCCGC
TCCATGGAGGCGCCCGGCATCCTCATTCAACGCGCCATCCTCCACGGAATCCAAGAGGGCCGCGGCGGCCTTGGC
TCCATCTTCGTCTTTGCCAGTGGTAACGGCGCCGCAAGCGACGACAACTGCAACTTTGACGGCTACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCATACTACTCCGAGTTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGCGACGGCGATTCCATCCACACCACCGATGTCGGCACGAACCAGTGCACCTCT
AGCCACGGCGGAACGTCGGCTGCCGCTCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCCGGCCCGAT
CTGGGCTGGCGAGACGTCCAGTATCTGGCCATGGAGACGGCTCAGCCCATCGCCGACCAGCCCGAGAGCTGGCAG
ACGACGAGCATCGGCAAGAAATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGG
GCCAAGACGTGGACCAAGGTGAAGCCACAGGCTTGGTTCTTTTCACCCTGGATCCACGTCAAGACGGCCATACCA
GAGGGTGGCGACGGCTTGACCGCTCACTTCGAGGTCACGAGCGATATGATAAAGAAGGCCAACCTGGAGCGCGTC
GAGCACGTTACCATCACCATGAACGTCAATCACACACGCCGCGGCGACCTCAGCGTCGATCTCGTCAGTCCGCAG
AACGTCGTGAGTCACATCGCGACGGCCAGGACTCACGATAGCCACAACGGGGGCTACGTCGACTGGACCTTTATG
ACCGTCGTCCACTGGGGCGAGTCTGGTATCGGGAACTGGAGCCTGGTGGTCCATGACACGAAGGAGAACAAGCAT
CGCGGCACCTTTGTCGACTGGCGCATGAAGCTCTGGGGCGAGGCCATCGACGCCGGCGCCGCCCATCACTTGCCC
ATGCCCGAGACGACCGACGACGACGATCACGACAAGACGGTCTCGTCCGTGGCCGGGCCCGTCGCCACCTCGAGC
GGCCGACCGGGCCAGAAGCCACCACCACAGCCAACCATGACAGCTCTGCCATCGGATCATCCGGAACGTCCGACC
AAGCCCGGAAGCGCACAGCTGTCGCCATCGGCCAGCGTGGTGCCGTCGCCCGCGGCCAAGGCGGGACCCTATTGG
ATCTACGGCGCCTTTTGCCTCATCATCGTCTTCTGCATCGGCCTGGGCGCCTATCTATGGATCGCTCGCCGCCGT
CGGCTGAGGAACAAGGCGCGCGACAGTTACGAGTTCGAGCTCATCGACGAGGAGGAAACCGAAGCCATCAACGGT
CTCGAAAAGGACGCGGCCGGCGGTCGGCGCGGAGGACGACGAACCCGTGGCGGAGAGCTATACGACGCCTTTGCC
GGGAACAGCGACGATGACGACGACGACGACGAGGATGGCACGCGCGAGGTGCGAGAGTACAGAGACGGTTCGCAA
GATAGGCTGACGCCCTCGGACGAGGCGGAGCAGTACGTCGTGGGCGAGGAGAGCGACGATGACGATGACGCAGAG
GCCGTCTCGCCCAAGGACTCGAAGCTACTGGGCGGCAGAGCACCATGA
Transcript >Ophun1|518
ATGGCCTTTCGAGACTATGATCTCTTCGACTATTATGTCGTTCACCTCGCCGAGTCCGCTTCTCCGGAAGAGATC
GCTTCGGAGCTGGGTATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTCATGAAGCGAGATGGTCAAGAGGATCACGTCGTT
CGTCACGTCTTGCTCGCACGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCTGGTCCGGCT
GCTGCCCTGCGATCCCGCGCCTTCAAGTTGCCGCTCGACACGGCGACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCGACATTCACGACCCCATGTTTGAGGAGCAATGGCATCTGCTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGCCTGTGGCTCGAGGGCATCACGGGCAAGGATGCCACAGTGGCCATCGTCGACGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAACTACTTCGCCGCCGGCTCCTGGGACTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGTCTGTCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGAAACGACGTCTGC
GGCGTCGGAGCTGCCTACGATGCCCGCGTCGCCGGCATCCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCCGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGGCCCCGCGACGATGGCCGC
TCCATGGAGGCGCCCGGCATCCTCATTCAACGCGCCATCCTCCACGGAATCCAAGAGGGCCGCGGCGGCCTTGGC
TCCATCTTCGTCTTTGCCAGTGGTAACGGCGCCGCAAGCGACGACAACTGCAACTTTGACGGCTACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCATACTACTCCGAGTTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGCGACGGCGATTCCATCCACACCACCGATGTCGGCACGAACCAGTGCACCTCT
AGCCACGGCGGAACGTCGGCTGCCGCTCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCCGGCCCGAT
CTGGGCTGGCGAGACGTCCAGTATCTGGCCATGGAGACGGCTCAGCCCATCGCCGACCAGCCCGAGAGCTGGCAG
ACGACGAGCATCGGCAAGAAATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGG
GCCAAGACGTGGACCAAGGTGAAGCCACAGGCTTGGTTCTTTTCACCCTGGATCCACGTCAAGACGGCCATACCA
GAGGGTGGCGACGGCTTGACCGCTCACTTCGAGGTCACGAGCGATATGATAAAGAAGGCCAACCTGGAGCGCGTC
GAGCACGTTACCATCACCATGAACGTCAATCACACACGCCGCGGCGACCTCAGCGTCGATCTCGTCAGTCCGCAG
AACGTCGTGAGTCACATCGCGACGGCCAGGACTCACGATAGCCACAACGGGGGCTACGTCGACTGGACCTTTATG
ACCGTCGTCCACTGGGGCGAGTCTGGTATCGGGAACTGGAGCCTGGTGGTCCATGACACGAAGGAGAACAAGCAT
CGCGGCACCTTTGTCGACTGGCGCATGAAGCTCTGGGGCGAGGCCATCGACGCCGGCGCCGCCCATCACTTGCCC
ATGCCCGAGACGACCGACGACGACGATCACGACAAGACGGTCTCGTCCGTGGCCGGGCCCGTCGCCACCTCGAGC
GGCCGACCGGGCCAGAAGCCACCACCACAGCCAACCATGACAGCTCTGCCATCGGATCATCCGGAACGTCCGACC
AAGCCCGGAAGCGCACAGCTGTCGCCATCGGCCAGCGTGGTGCCGTCGCCCGCGGCCAAGGCGGGACCCTATTGG
ATCTACGGCGCCTTTTGCCTCATCATCGTCTTCTGCATCGGCCTGGGCGCCTATCTATGGATCGCTCGCCGCCGT
CGGCTGAGGAACAAGGCGCGCGACAGTTACGAGTTCGAGCTCATCGACGAGGAGGAAACCGAAGCCATCAACGGT
CTCGAAAAGGACGCGGCCGGCGGTCGGCGCGGAGGACGACGAACCCGTGGCGGAGAGCTATACGACGCCTTTGCC
GGGAACAGCGACGATGACGACGACGACGACGAGGATGGCACGCGCGAGGTGCGAGAGTACAGAGACGGTTCGCAA
GATAGGCTGACGCCCTCGGACGAGGCGGAGCAGTACGTCGTGGGCGAGGAGAGCGACGATGACGATGACGCAGAG
GCCGTCTCGCCCAAGGACTCGAAGCTACTGGGCGGCAGAGCACCATGA
Gene >Ophun1|518
ATGGCCTTTCGAGACTATGATCTCTTCGACTATTATGTCGTTCACCTCGCCGAGTCCGCTTCTCCGGAAGAGATC
GCTTCGGAGCTGGGTATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTCATGAAGCGAGATGGTCAAGAGGATCACGTCGTT
CGTCACGTCTTGCTCGCACGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCTGGTCCGGCT
GCTGCCCTGCGATCCCGCGCCTTCAAGTTGCCGCTCGACACGGCGACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCGACATTCACGACCCCATGTTTGAGGAGCAATGGCATCTGCTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGCCTGTGGCTCGAGGGCATCACGGGCAAGGATGCCACAGTGGCCATCGTCGACGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAACTACTTCGCCGCCGGCTCCTGGGACTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGTCTGTCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGAAACGACGTCTGC
GGCGTCGGAGCTGCCTACGATGCCCGCGTCGCCGGCATCCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCCGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGGCCCCGCGACGATGGCCGC
TCCATGGAGGCGCCCGGCATCCTCATTCAACGCGCCATCCTCCACGGAATCCAAGAGGGCCGCGGCGGCCTTGGC
TCCATCTTCGTCTTTGCCAGTGGTAACGGCGCCGCAAGCGACGACAACTGCAACTTTGACGGCTACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCATACTACTCCGAGTTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGCGACGGCGATTCCATCGTGCGTCTTTTTCTTCCCCTTTTGTTTCGACTAGTG
CTGACCCTCGGCTTTACCCGCAGCACACCACCGATGTCGGCACGAACCAGTGCACCTCTAGCCACGGCGGAACGT
CGGCTGCCGCTCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCCGGCCCGATCTGGGCTGGCGAGACG
TCCAGTATCTGGCCATGGAGACGGCTCAGCCCATCGCCGACCAGCCCGAGAGCTGGCAGACGACGAGCATCGGCA
AGAAATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGGGCCAAGACGTGGACCA
AGGTGAAGCCACAGGCTTGGTTCTTTTCACCCTGGATCCACGTCAAGACGGCCATACCAGAGGGTGGCGACGGCT
TGACCGCTCACTTCGAGGTCACGAGCGATATGATAAAGAAGGCCAACCTGGAGCGCGTCGAGCACGTTACCATCA
CCATGAACGTCAATCACACACGCCGCGGCGACCTCAGCGTCGATCTCGTCAGTCCGCAGAACGTCGTGAGTCACA
TCGCGACGGCCAGGACTCACGATAGCCACAACGGGGGCTACGTCGACTGGACCTTTATGACCGTCGTCCACTGGT
GAGCCCGAAGCTGTTCCCGATTCTGCTCCCACACTGACTCTCTTGTTCTTCTCAGGGGCGAGTCTGGTATCGGGA
ACTGGAGCCTGGTGGTCCATGACACGAAGGAGAACAAGCATCGCGGCACCTTTGTCGACTGGCGCATGAAGCTCT
GGGGCGAGGCCATCGACGCCGGCGCCGCCCATCACTTGCCCATGCCCGAGACGACCGACGACGACGATCACGACA
AGACGGTCTCGTCCGTGGCCGGGCCCGTCGCCACCTCGAGCGGCCGACCGGGCCAGAAGCCACCACCACAGCCAA
CCATGACAGCTCTGCCATCGGATCATCCGGAACGTCCGACCAAGCCCGGAAGCGCACAGCTGTCGCCATCGGCCA
GCGTGGTGCCGTCGCCCGCGGCCAAGGCGGGACCCTATTGGATCTACGGCGCCTTTTGCCTCATCATCGTCTTCT
GCATCGGCCTGGGCGCCTATCTATGGATCGCTCGCCGCCGTCGGCTGAGGAACAAGGCGCGCGACAGTTACGAGT
TCGAGCTCATCGACGAGGAGGAAACCGAAGCCATCAACGGTCTCGAAAAGGACGCGGCCGGCGGTCGGCGCGGAG
GACGACGAACCCGTGGCGGAGAGCTATACGACGCCTTTGCCGGGAACAGCGACGATGACGACGACGACGACGAGG
ATGGCACGCGCGAGGTGCGAGAGTACAGAGACGGTTCGCAAGATAGGCTGACGCCCTCGGACGAGGCGGAGCAGT
ACGTCGTGGGCGAGGAGAGCGACGATGACGATGACGCAGAGGCCGTCTCGCCCAAGGACTCGAAGCTACTGGGCG
GCAGAGCACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail