Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5177
Gene name
LocationContig_5:54985..57835
Strand+
Gene length (bp)2850
Transcript length (bp)2850
Coding sequence length (bp)2850
Protein length (aa) 950

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 6.0E-34 138 314
PF08628 Nexin_C Sorting nexin C terminal 1.6E-19 813 929
PF00787 PX PX domain 2.5E-05 494 569

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 64 86 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5177
MASSDAKAGPYVRPAAAPDPPPRLDSDSRSPSQQLSAKALQFISTASPGTLAGIAVAFSGVTYAILGRLGLLVIG
AVGGVIAFASFEAKHPDVARAVRGEKGPEVLDRLWADLQNTGSSSALDADDDGQLKAFDDFRPETREALSAFVDA
IIRDYVKWWYSPLVPTDHSFPLACRKTLNAYVMAISNRLSRKRPADAFLDLLTNCSSIIIVFMSELAAAYADLPP
DTNMTAADAIYNYLASNPDSRLASLLNQRQQAAKFKMVAEDLLVFLDQAPQSCDPARVFLREILANSVLETTLQS
CSKAEWINGWIVHLLEAGEPDLNQAIDVGMQTGPDNNVFADLDGNVGNIGIAKPGRSSPEAERSRRKDSSPHSSS
SSSKSPPRRDEPLVHGEVDSMSTPSRWSMAGSSRDSPSPAAAAANRSSGQQFTSFDQIVAHGSGQTAEQEAPKKE
QLHLHNASFTLHDDTTGDGGKIRNKPSWDYLIQVEPSLAVISGWMIVRRYSDFETLHEILRRIATVSGATAFTEL
HKELPGWKMHTRESLRGELERYLRDACWYASLAESEGMKRFLEKSQGHTHGGSKSFGWETVGKNMLDALTIGPKG
AVEGGKNLVGVLGGFPGLGRKPTTPLSAVETGGAGPAGRLSRSNPSPVAKSPARSERASTDSQRSSVISTQPGKV
APMDRRASHQLDADAVDYTRVGRSDRTDSGSSSAHPSREHSRASSLAPVQSPSMSSIDMMKLPPPPDEVEDDYVG
LGDGSPPQHDRRRSSIMTNGGGKKAAPSRPARQYSHLSEHETRVAVELLFAVINEMYTLSSAWNIRRTLLTAAKS
FLLRPGNPSLLTVQSLIQSSLLDANTSDAGIASTVRKLRENSLPTEAERAAWPEDLSADERDRLAVKARRMLVQR
GVPAALMGVMGQAATGDALGRVFDCLQIEEVARGLVFGLMLQMVRIVTH*
Coding >Ophun1|5177
ATGGCCTCTTCCGATGCAAAGGCCGGCCCTTATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGTCTCGAT
AGCGACTCCCGAAGCCCCTCGCAGCAACTGAGCGCAAAAGCCCTCCAATTCATATCGACCGCCTCGCCAGGCACC
CTTGCCGGCATCGCAGTCGCCTTCTCCGGCGTCACGTACGCTATACTCGGTCGGCTGGGTCTGCTGGTTATTGGC
GCTGTCGGCGGCGTCATCGCTTTTGCGTCTTTCGAGGCCAAACACCCCGACGTGGCCAGGGCTGTGCGAGGCGAA
AAGGGACCTGAAGTCCTCGACCGGCTTTGGGCTGACCTGCAGAATACGGGCTCGTCGTCGGCTCTCGACGCTGAT
GACGATGGACAGCTCAAGGCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCTCTCTCGGCTTTTGTCGATGCC
ATTATCCGCGACTACGTCAAGTGGTGGTACAGCCCCCTCGTGCCCACCGACCACTCGTTCCCCCTGGCTTGTCGC
AAAACTCTCAACGCCTACGTCATGGCTATATCCAATCGACTGTCTCGCAAACGCCCCGCCGATGCCTTTCTCGAC
CTCCTTACCAACTGCTCATCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCCGACCTCCCTCCC
GATACAAACATGACGGCCGCTGATGCCATATACAACTATCTGGCGTCAAACCCCGACTCGCGCCTGGCCAGTCTC
CTCAACCAGCGCCAGCAGGCTGCCAAGTTTAAGATGGTGGCCGAGGACTTGTTGGTCTTTCTTGATCAGGCGCCT
CAGAGCTGCGACCCTGCCCGCGTCTTCCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCT
TGCAGCAAAGCCGAGTGGATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCC
ATCGACGTCGGCATGCAGACTGGCCCAGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGC
ATTGCCAAGCCCGGTCGGTCTAGCCCGGAGGCGGAGCGCAGCCGGCGAAAAGACTCGTCCCCTCATAGCAGCAGC
AGCAGTAGCAAGAGTCCGCCTCGACGTGACGAGCCACTGGTCCACGGCGAGGTTGACAGCATGTCGACACCCTCT
CGATGGTCCATGGCTGGCTCCAGCCGGGACTCACCCTCTCCCGCTGCTGCTGCCGCCAATAGGTCGAGCGGACAG
CAATTTACGAGTTTCGACCAGATCGTCGCCCACGGATCGGGACAGACGGCGGAGCAAGAGGCGCCGAAAAAGGAA
CAGCTTCATCTGCACAATGCGTCTTTTACCTTGCACGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAG
CCCAGCTGGGACTACTTGATCCAGGTCGAGCCGTCGTTGGCCGTGATTTCGGGCTGGATGATTGTCAGAAGATAC
TCGGATTTCGAGACGCTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCCTTTACCGAGCTA
CACAAGGAGCTGCCCGGGTGGAAGATGCACACGCGCGAGTCGCTGCGGGGGGAGCTGGAGCGATACCTGCGAGAC
GCGTGCTGGTACGCGTCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACTCAC
GGAGGCTCCAAGTCCTTTGGCTGGGAGACGGTCGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGC
GCCGTCGAGGGCGGCAAGAATCTGGTGGGTGTCCTGGGCGGCTTCCCGGGCCTCGGTCGGAAGCCGACGACCCCA
CTGTCGGCAGTCGAGACCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCCCCGGTGGCCAAA
TCGCCGGCCCGATCGGAGCGAGCCAGCACCGACAGCCAGCGATCATCAGTCATCTCAACGCAGCCCGGTAAAGTA
GCGCCCATGGACAGAAGAGCAAGCCACCAGCTCGACGCCGACGCCGTCGACTACACGCGCGTAGGCCGCTCCGAC
CGCACCGACTCGGGCTCCAGCAGCGCGCACCCCAGCCGAGAACACAGCCGGGCATCCAGCCTCGCGCCCGTTCAG
TCCCCGTCCATGTCGAGCATCGACATGATGAAGCTCCCGCCTCCGCCAGACGAGGTTGAAGACGACTACGTCGGT
CTCGGCGACGGCTCCCCCCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGCGGCGGCAAAAAGGCG
GCCCCCTCCCGTCCAGCACGACAATACTCGCACCTCTCAGAACACGAAACCCGCGTCGCCGTCGAACTCCTCTTC
GCCGTCATCAACGAAATGTACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTCACCGCCGCAAAATCC
TTCCTCCTCCGCCCCGGAAACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCCAAC
ACCTCGGACGCGGGCATCGCCTCCACCGTCCGCAAGCTCCGCGAGAACAGCCTCCCCACCGAGGCCGAGCGCGCC
GCCTGGCCCGAGGACCTCTCCGCCGACGAAAGGGACAGGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGCGG
GGCGTCCCCGCCGCGCTCATGGGCGTCATGGGGCAGGCGGCCACGGGGGATGCGCTGGGGAGGGTCTTTGATTGC
TTGCAGATTGAGGAGGTTGCTAGGGGGTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA
Transcript >Ophun1|5177
ATGGCCTCTTCCGATGCAAAGGCCGGCCCTTATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGTCTCGAT
AGCGACTCCCGAAGCCCCTCGCAGCAACTGAGCGCAAAAGCCCTCCAATTCATATCGACCGCCTCGCCAGGCACC
CTTGCCGGCATCGCAGTCGCCTTCTCCGGCGTCACGTACGCTATACTCGGTCGGCTGGGTCTGCTGGTTATTGGC
GCTGTCGGCGGCGTCATCGCTTTTGCGTCTTTCGAGGCCAAACACCCCGACGTGGCCAGGGCTGTGCGAGGCGAA
AAGGGACCTGAAGTCCTCGACCGGCTTTGGGCTGACCTGCAGAATACGGGCTCGTCGTCGGCTCTCGACGCTGAT
GACGATGGACAGCTCAAGGCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCTCTCTCGGCTTTTGTCGATGCC
ATTATCCGCGACTACGTCAAGTGGTGGTACAGCCCCCTCGTGCCCACCGACCACTCGTTCCCCCTGGCTTGTCGC
AAAACTCTCAACGCCTACGTCATGGCTATATCCAATCGACTGTCTCGCAAACGCCCCGCCGATGCCTTTCTCGAC
CTCCTTACCAACTGCTCATCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCCGACCTCCCTCCC
GATACAAACATGACGGCCGCTGATGCCATATACAACTATCTGGCGTCAAACCCCGACTCGCGCCTGGCCAGTCTC
CTCAACCAGCGCCAGCAGGCTGCCAAGTTTAAGATGGTGGCCGAGGACTTGTTGGTCTTTCTTGATCAGGCGCCT
CAGAGCTGCGACCCTGCCCGCGTCTTCCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCT
TGCAGCAAAGCCGAGTGGATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCC
ATCGACGTCGGCATGCAGACTGGCCCAGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGC
ATTGCCAAGCCCGGTCGGTCTAGCCCGGAGGCGGAGCGCAGCCGGCGAAAAGACTCGTCCCCTCATAGCAGCAGC
AGCAGTAGCAAGAGTCCGCCTCGACGTGACGAGCCACTGGTCCACGGCGAGGTTGACAGCATGTCGACACCCTCT
CGATGGTCCATGGCTGGCTCCAGCCGGGACTCACCCTCTCCCGCTGCTGCTGCCGCCAATAGGTCGAGCGGACAG
CAATTTACGAGTTTCGACCAGATCGTCGCCCACGGATCGGGACAGACGGCGGAGCAAGAGGCGCCGAAAAAGGAA
CAGCTTCATCTGCACAATGCGTCTTTTACCTTGCACGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAG
CCCAGCTGGGACTACTTGATCCAGGTCGAGCCGTCGTTGGCCGTGATTTCGGGCTGGATGATTGTCAGAAGATAC
TCGGATTTCGAGACGCTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCCTTTACCGAGCTA
CACAAGGAGCTGCCCGGGTGGAAGATGCACACGCGCGAGTCGCTGCGGGGGGAGCTGGAGCGATACCTGCGAGAC
GCGTGCTGGTACGCGTCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACTCAC
GGAGGCTCCAAGTCCTTTGGCTGGGAGACGGTCGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGC
GCCGTCGAGGGCGGCAAGAATCTGGTGGGTGTCCTGGGCGGCTTCCCGGGCCTCGGTCGGAAGCCGACGACCCCA
CTGTCGGCAGTCGAGACCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCCCCGGTGGCCAAA
TCGCCGGCCCGATCGGAGCGAGCCAGCACCGACAGCCAGCGATCATCAGTCATCTCAACGCAGCCCGGTAAAGTA
GCGCCCATGGACAGAAGAGCAAGCCACCAGCTCGACGCCGACGCCGTCGACTACACGCGCGTAGGCCGCTCCGAC
CGCACCGACTCGGGCTCCAGCAGCGCGCACCCCAGCCGAGAACACAGCCGGGCATCCAGCCTCGCGCCCGTTCAG
TCCCCGTCCATGTCGAGCATCGACATGATGAAGCTCCCGCCTCCGCCAGACGAGGTTGAAGACGACTACGTCGGT
CTCGGCGACGGCTCCCCCCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGCGGCGGCAAAAAGGCG
GCCCCCTCCCGTCCAGCACGACAATACTCGCACCTCTCAGAACACGAAACCCGCGTCGCCGTCGAACTCCTCTTC
GCCGTCATCAACGAAATGTACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTCACCGCCGCAAAATCC
TTCCTCCTCCGCCCCGGAAACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCCAAC
ACCTCGGACGCGGGCATCGCCTCCACCGTCCGCAAGCTCCGCGAGAACAGCCTCCCCACCGAGGCCGAGCGCGCC
GCCTGGCCCGAGGACCTCTCCGCCGACGAAAGGGACAGGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGCGG
GGCGTCCCCGCCGCGCTCATGGGCGTCATGGGGCAGGCGGCCACGGGGGATGCGCTGGGGAGGGTCTTTGATTGC
TTGCAGATTGAGGAGGTTGCTAGGGGGTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA
Gene >Ophun1|5177
ATGGCCTCTTCCGATGCAAAGGCCGGCCCTTATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGTCTCGAT
AGCGACTCCCGAAGCCCCTCGCAGCAACTGAGCGCAAAAGCCCTCCAATTCATATCGACCGCCTCGCCAGGCACC
CTTGCCGGCATCGCAGTCGCCTTCTCCGGCGTCACGTACGCTATACTCGGTCGGCTGGGTCTGCTGGTTATTGGC
GCTGTCGGCGGCGTCATCGCTTTTGCGTCTTTCGAGGCCAAACACCCCGACGTGGCCAGGGCTGTGCGAGGCGAA
AAGGGACCTGAAGTCCTCGACCGGCTTTGGGCTGACCTGCAGAATACGGGCTCGTCGTCGGCTCTCGACGCTGAT
GACGATGGACAGCTCAAGGCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCTCTCTCGGCTTTTGTCGATGCC
ATTATCCGCGACTACGTCAAGTGGTGGTACAGCCCCCTCGTGCCCACCGACCACTCGTTCCCCCTGGCTTGTCGC
AAAACTCTCAACGCCTACGTCATGGCTATATCCAATCGACTGTCTCGCAAACGCCCCGCCGATGCCTTTCTCGAC
CTCCTTACCAACTGCTCATCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCCGACCTCCCTCCC
GATACAAACATGACGGCCGCTGATGCCATATACAACTATCTGGCGTCAAACCCCGACTCGCGCCTGGCCAGTCTC
CTCAACCAGCGCCAGCAGGCTGCCAAGTTTAAGATGGTGGCCGAGGACTTGTTGGTCTTTCTTGATCAGGCGCCT
CAGAGCTGCGACCCTGCCCGCGTCTTCCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCT
TGCAGCAAAGCCGAGTGGATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCC
ATCGACGTCGGCATGCAGACTGGCCCAGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGC
ATTGCCAAGCCCGGTCGGTCTAGCCCGGAGGCGGAGCGCAGCCGGCGAAAAGACTCGTCCCCTCATAGCAGCAGC
AGCAGTAGCAAGAGTCCGCCTCGACGTGACGAGCCACTGGTCCACGGCGAGGTTGACAGCATGTCGACACCCTCT
CGATGGTCCATGGCTGGCTCCAGCCGGGACTCACCCTCTCCCGCTGCTGCTGCCGCCAATAGGTCGAGCGGACAG
CAATTTACGAGTTTCGACCAGATCGTCGCCCACGGATCGGGACAGACGGCGGAGCAAGAGGCGCCGAAAAAGGAA
CAGCTTCATCTGCACAATGCGTCTTTTACCTTGCACGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAG
CCCAGCTGGGACTACTTGATCCAGGTCGAGCCGTCGTTGGCCGTGATTTCGGGCTGGATGATTGTCAGAAGATAC
TCGGATTTCGAGACGCTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCCTTTACCGAGCTA
CACAAGGAGCTGCCCGGGTGGAAGATGCACACGCGCGAGTCGCTGCGGGGGGAGCTGGAGCGATACCTGCGAGAC
GCGTGCTGGTACGCGTCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACTCAC
GGAGGCTCCAAGTCCTTTGGCTGGGAGACGGTCGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGC
GCCGTCGAGGGCGGCAAGAATCTGGTGGGTGTCCTGGGCGGCTTCCCGGGCCTCGGTCGGAAGCCGACGACCCCA
CTGTCGGCAGTCGAGACCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCCCCGGTGGCCAAA
TCGCCGGCCCGATCGGAGCGAGCCAGCACCGACAGCCAGCGATCATCAGTCATCTCAACGCAGCCCGGTAAAGTA
GCGCCCATGGACAGAAGAGCAAGCCACCAGCTCGACGCCGACGCCGTCGACTACACGCGCGTAGGCCGCTCCGAC
CGCACCGACTCGGGCTCCAGCAGCGCGCACCCCAGCCGAGAACACAGCCGGGCATCCAGCCTCGCGCCCGTTCAG
TCCCCGTCCATGTCGAGCATCGACATGATGAAGCTCCCGCCTCCGCCAGACGAGGTTGAAGACGACTACGTCGGT
CTCGGCGACGGCTCCCCCCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGCGGCGGCAAAAAGGCG
GCCCCCTCCCGTCCAGCACGACAATACTCGCACCTCTCAGAACACGAAACCCGCGTCGCCGTCGAACTCCTCTTC
GCCGTCATCAACGAAATGTACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTCACCGCCGCAAAATCC
TTCCTCCTCCGCCCCGGAAACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCCAAC
ACCTCGGACGCGGGCATCGCCTCCACCGTCCGCAAGCTCCGCGAGAACAGCCTCCCCACCGAGGCCGAGCGCGCC
GCCTGGCCCGAGGACCTCTCCGCCGACGAAAGGGACAGGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGCGG
GGCGTCCCCGCCGCGCTCATGGGCGTCATGGGGCAGGCGGCCACGGGGGATGCGCTGGGGAGGGTCTTTGATTGC
TTGCAGATTGAGGAGGTTGCTAGGGGGTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail