Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5175
Gene name
LocationContig_5:51869..52994
Strand+
Gene length (bp)1125
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 5.8E-10 77 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 73 142 8.0E-08
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 76 140 2.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 76 147 5.0E-07
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 76 145 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 73 142 8.0E-08
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 76 140 2.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 76 147 5.0E-07
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 76 145 5.0E-07
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 76 147 5.0E-07
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 76 145 7.0E-07
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 76 144 7.0E-07
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 76 144 8.0E-07
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 73 140 9.0E-07
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 78 143 1.0E-06
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 76 144 1.0E-06
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 77 142 1.0E-06
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 73 143 1.0E-06
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 76 140 1.0E-06
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 73 143 1.0E-06
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 76 144 1.0E-06
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 73 144 2.0E-06
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 78 143 2.0E-06
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 73 143 2.0E-06
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 73 143 3.0E-06
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 73 144 3.0E-06
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 76 147 3.0E-06
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 76 147 3.0E-06
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 76 147 3.0E-06
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 73 143 3.0E-06
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 73 143 3.0E-06
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 76 144 3.0E-06
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 73 142 4.0E-06
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 73 142 4.0E-06
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 77 142 4.0E-06
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 76 144 4.0E-06
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 73 143 5.0E-06
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 77 146 5.0E-06
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 77 146 5.0E-06
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 73 143 5.0E-06
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 73 143 5.0E-06
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 77 146 5.0E-06
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 73 143 5.0E-06
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 73 143 5.0E-06
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 73 143 6.0E-06
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 76 144 6.0E-06
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 73 143 6.0E-06
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 73 143 6.0E-06
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 76 144 6.0E-06
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 76 144 6.0E-06
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 71 143 7.0E-06
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 71 145 7.0E-06
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 76 140 7.0E-06
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 73 140 7.0E-06
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 73 140 7.0E-06
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 73 142 7.0E-06
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 76 143 8.0E-06
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 71 145 8.0E-06
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 78 143 8.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 73 143 9.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 73 143 9.0E-06
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 73 143 9.0E-06
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 76 144 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 51 68 17
3 159 181 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5175
MSQSFSMIGWYILPGLATSVIQTIYYGLTIRAGDPKPAPESARHAAHRRNIKMAVVIIYLLYTIFEAYHDIRADP
SYYEELGVPLDAGEREIRSRFRRVAAMHHPDKTGSEDDGFFFMHLKAVSDTLQHSAKRFAYERFGPAVVTWTECV
TIREFVTRGFLLSILPHYSIAAATIYLLGLTGYMGTAKLHRWLMLVGLCLFELHAVTRPEFPAVVRVVNAVATRL
PPYTPLLPFQIIKLAQKIVLTLCIGIAQIGPLLAEQSAARRRAGPRDEKLLQQALDRLEVASSQLDTETTRMVAL
EMAPFKGDEMAVRNLRDKMREWLVQNTIRADPMVRDAMGTSLRRRRIDAPSGAKGTR*
Coding >Ophun1|5175
ATGTCCCAATCCTTTTCCATGATCGGATGGTACATCCTACCCGGCCTCGCTACCTCGGTGATCCAGACCATCTAC
TATGGCCTCACGATCCGCGCAGGCGACCCCAAGCCCGCGCCCGAATCGGCCCGTCATGCCGCCCACCGCCGCAAC
ATCAAGATGGCCGTCGTGATAATCTATCTGCTCTACACAATCTTCGAGGCCTATCACGATATCCGTGCCGACCCG
TCGTACTACGAGGAACTCGGCGTGCCGCTCGACGCGGGCGAGCGCGAGATTCGCTCCCGCTTTCGCAGGGTCGCA
GCCATGCATCACCCGGATAAGACCGGTAGTGAAGACGACGGCTTCTTCTTTATGCATCTCAAGGCTGTCAGCGAC
ACGCTGCAGCACAGCGCCAAACGCTTCGCCTACGAACGTTTCGGCCCGGCCGTCGTCACATGGACCGAGTGCGTC
ACCATCCGCGAGTTCGTCACCAGGGGCTTCCTCCTCTCCATCCTCCCACACTATTCCATCGCCGCTGCCACCATC
TACCTCCTCGGACTCACCGGCTACATGGGGACGGCCAAGCTTCACCGCTGGTTGATGCTCGTTGGCCTCTGCCTC
TTTGAGCTGCACGCCGTTACCCGGCCCGAGTTCCCCGCCGTCGTCCGCGTCGTCAACGCTGTCGCCACCCGTCTT
CCGCCTTATACCCCCTTGCTCCCCTTTCAGATCATCAAGCTCGCTCAGAAGATCGTTCTCACCCTCTGCATTGGT
ATTGCACAGATTGGGCCCCTCTTGGCCGAGCAGTCGGCCGCCCGCCGTCGCGCCGGCCCCCGCGACGAAAAGCTC
TTGCAGCAGGCACTCGATCGCCTCGAGGTTGCGTCCAGTCAGCTGGACACAGAGACGACACGCATGGTGGCGCTA
GAAATGGCGCCTTTCAAGGGCGACGAGATGGCTGTCCGCAACCTCCGGGACAAGATGCGCGAGTGGCTGGTTCAA
AACACGATACGTGCCGATCCCATGGTCCGGGATGCCATGGGGACTTCGTTGAGGAGGAGAAGAATAGATGCGCCG
AGTGGTGCCAAGGGGACCAGATAG
Transcript >Ophun1|5175
ATGTCCCAATCCTTTTCCATGATCGGATGGTACATCCTACCCGGCCTCGCTACCTCGGTGATCCAGACCATCTAC
TATGGCCTCACGATCCGCGCAGGCGACCCCAAGCCCGCGCCCGAATCGGCCCGTCATGCCGCCCACCGCCGCAAC
ATCAAGATGGCCGTCGTGATAATCTATCTGCTCTACACAATCTTCGAGGCCTATCACGATATCCGTGCCGACCCG
TCGTACTACGAGGAACTCGGCGTGCCGCTCGACGCGGGCGAGCGCGAGATTCGCTCCCGCTTTCGCAGGGTCGCA
GCCATGCATCACCCGGATAAGACCGGTAGTGAAGACGACGGCTTCTTCTTTATGCATCTCAAGGCTGTCAGCGAC
ACGCTGCAGCACAGCGCCAAACGCTTCGCCTACGAACGTTTCGGCCCGGCCGTCGTCACATGGACCGAGTGCGTC
ACCATCCGCGAGTTCGTCACCAGGGGCTTCCTCCTCTCCATCCTCCCACACTATTCCATCGCCGCTGCCACCATC
TACCTCCTCGGACTCACCGGCTACATGGGGACGGCCAAGCTTCACCGCTGGTTGATGCTCGTTGGCCTCTGCCTC
TTTGAGCTGCACGCCGTTACCCGGCCCGAGTTCCCCGCCGTCGTCCGCGTCGTCAACGCTGTCGCCACCCGTCTT
CCGCCTTATACCCCCTTGCTCCCCTTTCAGATCATCAAGCTCGCTCAGAAGATCGTTCTCACCCTCTGCATTGGT
ATTGCACAGATTGGGCCCCTCTTGGCCGAGCAGTCGGCCGCCCGCCGTCGCGCCGGCCCCCGCGACGAAAAGCTC
TTGCAGCAGGCACTCGATCGCCTCGAGGTTGCGTCCAGTCAGCTGGACACAGAGACGACACGCATGGTGGCGCTA
GAAATGGCGCCTTTCAAGGGCGACGAGATGGCTGTCCGCAACCTCCGGGACAAGATGCGCGAGTGGCTGGTTCAA
AACACGATACGTGCCGATCCCATGGTCCGGGATGCCATGGGGACTTCGTTGAGGAGGAGAAGAATAGATGCGCCG
AGTGGTGCCAAGGGGACCAGATAG
Gene >Ophun1|5175
ATGTCCCAATCCTTTTCCATGATCGGATGGTACATCCTACCCGGCGTCCGTCTCCCTCCCGTCTCTCCTGTCTGG
CAGCAGCTGACCTCCTCATAGCTCGCTACCTCGGTGATCCAGACCATCTACTATGGCCTCACGATCCGCGCAGGC
GACCCCAAGCCCGCGCCCGAATCGGCCCGTCATGCCGCCCACCGCCGCAACATCAAGATGGCCGTCGTGATAATC
TATCTGCTCTACACAATCTTCGAGGCCTATCACGATATCCGTGCCGACCCGTCGTACTACGAGGAACTCGGCGTG
CCGCTCGACGCGGGCGAGCGCGAGATTCGCTCCCGCTTTCGCAGGGTCGCAGCCATGCATCACCCGGATAAGACC
GGTAGTGAAGACGACGGCTTCTTCTTTATGCATCTCAAGGCTGTCAGCGACACGCTGCAGCACAGCGCCAAACGC
TTCGCCTACGAACGTTTCGGCCCGGCCGTCGTCACATGGACCGAGTGCGTCACCATCCGCGAGTTCGTCACCAGG
GGCTTCCTCCTCTCCATCCTCCCACACTATTCCATCGCCGCTGCCACCATCTACCTCCTCGGACTCACCGGCTAC
ATGGGGACGGCCAAGCTTCACCGCTGGTTGATGCTCGTTGGCCTCTGCCTCTTTGAGCTGCACGCCGTTACCCGG
CCCGAGTTCCCCGCCGTCGTCCGCGTCGTCAACGCTGTCGCCACCCGTCTTCCGCCTTATACCCCCTTGCTCCCC
TTTCAGATCATCAAGCTCGCTCAGAAGATCGTTCTCACCCTCTGCATTGGTATTGCACAGATTGGGCCCCTCTTG
GCCGAGCAGTCGGCCGCCCGCCGTCGCGCCGGCCCCCGCGACGAAAAGCTCTTGCAGCAGGCACTCGATCGCCTC
GAGGTTGCGTCCAGTCAGCTGGACACAGAGACGACACGCATGGTGGCGCTAGAAATGGCGCCTTTCAAGGGCGAC
GAGATGGCTGTCCGCAACCTCCGGGACAAGATGCGCGAGTGGCTGGTTCAAAACACGATACGTGCCGATCCCATG
GTCCGGGATGCCATGGGGACTTCGTTGAGGAGGAGAAGAATAGATGCGCCGAGTGGTGCCAAGGGGACCAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail