Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5152
Gene name
LocationContig_5:3417..5162
Strand-
Gene length (bp)1745
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00588 SpoU_methylase SpoU rRNA Methylase family 7.2E-26 355 513
PF08032 SpoU_sub_bind RNA 2'-O ribose methyltransferase substrate binding 6.2E-08 224 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6IN84|MRM1_HUMAN rRNA methyltransferase 1, mitochondrial OS=Homo sapiens GN=MRM1 PE=1 SV=1 224 516 3.0E-25
sp|Q76NT0|MRM1_DICDI rRNA methyltransferase 1, mitochondrial OS=Dictyostelium discoideum GN=mrm1 PE=3 SV=1 276 519 1.0E-21
sp|O94631|MRM1_SCHPO rRNA methyltransferase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrm1 PE=3 SV=1 222 517 2.0E-21
sp|P25270|MRM1_YEAST rRNA methyltransferase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRM1 PE=1 SV=2 224 517 2.0E-21
sp|Q99J25|MRM1_MOUSE rRNA methyltransferase 1, mitochondrial OS=Mus musculus GN=Mrm1 PE=2 SV=2 280 516 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6IN84|MRM1_HUMAN rRNA methyltransferase 1, mitochondrial OS=Homo sapiens GN=MRM1 PE=1 SV=1 224 516 3.0E-25
sp|Q76NT0|MRM1_DICDI rRNA methyltransferase 1, mitochondrial OS=Dictyostelium discoideum GN=mrm1 PE=3 SV=1 276 519 1.0E-21
sp|O94631|MRM1_SCHPO rRNA methyltransferase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrm1 PE=3 SV=1 222 517 2.0E-21
sp|P25270|MRM1_YEAST rRNA methyltransferase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRM1 PE=1 SV=2 224 517 2.0E-21
sp|Q99J25|MRM1_MOUSE rRNA methyltransferase 1, mitochondrial OS=Mus musculus GN=Mrm1 PE=2 SV=2 280 516 7.0E-21
sp|O51468|Y516_BORBU Uncharacterized tRNA/rRNA methyltransferase BB_0516 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0516 PE=3 SV=1 322 513 9.0E-16
sp|Q7VP36|RLMB_HAEDU 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rlmB PE=3 SV=1 225 508 2.0E-15
sp|Q06753|YACO_BACSU Putative TrmH family tRNA/rRNA methyltransferase YacO OS=Bacillus subtilis (strain 168) GN=yacO PE=3 SV=2 224 512 3.0E-15
sp|Q7MYU6|RLMB_PHOLL 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rlmB PE=3 SV=1 222 508 3.0E-14
sp|Q8ZIV4|RLMB_YERPE 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Yersinia pestis GN=rlmB PE=3 SV=1 222 508 4.0E-14
sp|P74328|Y955_SYNY3 Uncharacterized tRNA/rRNA methyltransferase slr0955 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0955 PE=3 SV=1 224 511 2.0E-13
sp|Q8ZKA2|RLMB_SALTY 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmB PE=3 SV=1 222 508 8.0E-13
sp|Q8Z182|RLMB_SALTI 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Salmonella typhi GN=rlmB PE=3 SV=1 222 508 2.0E-12
sp|P63180|RLMB_SHIFL 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Shigella flexneri GN=rlmB PE=3 SV=1 222 508 2.0E-12
sp|P63177|RLMB_ECOLI 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Escherichia coli (strain K12) GN=rlmB PE=1 SV=1 222 508 2.0E-12
sp|P63178|RLMB_ECOL6 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmB PE=3 SV=1 222 508 2.0E-12
sp|P63179|RLMB_ECO57 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Escherichia coli O157:H7 GN=rlmB PE=3 SV=1 222 508 2.0E-12
sp|Q9CJP3|RLMB_PASMU 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Pasteurella multocida (strain Pm70) GN=rlmB PE=3 SV=1 225 508 2.0E-12
sp|Q6D127|RLMB_PECAS 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmB PE=3 SV=1 222 508 3.0E-12
sp|Q4L3J1|TRMHL_STAHJ Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2477 PE=3 SV=1 223 512 5.0E-12
sp|P44906|RLMB_HAEIN 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rlmB PE=1 SV=1 225 508 7.0E-12
sp|Q8EAG8|RLMB_SHEON 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Shewanella oneidensis (strain MR-1) GN=rlmB PE=3 SV=1 224 508 8.0E-12
sp|Q6FF50|RLMB_ACIAD 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rlmB PE=3 SV=1 224 511 2.0E-11
sp|O30272|Y2399_ARCFU Uncharacterized tRNA/rRNA methyltransferase AF_2399 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2399 PE=3 SV=1 347 516 2.0E-11
sp|Q9HUM8|RLMB_PSEAE 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rlmB PE=3 SV=1 338 518 2.0E-11
sp|Q82XD1|RLMB_NITEU 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rlmB PE=3 SV=1 222 525 2.0E-11
sp|A4T5L0|Y1447_MYCGI Uncharacterized tRNA/rRNA methyltransferase Mflv_1447 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_1447 PE=3 SV=1 224 518 2.0E-11
sp|A0QAB6|Y574_MYCA1 Uncharacterized tRNA/rRNA methyltransferase MAV_0574 OS=Mycobacterium avium (strain 104) GN=MAV_0574 PE=3 SV=1 225 512 4.0E-11
sp|Q87L11|RLMB_VIBPA 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rlmB PE=3 SV=1 224 511 4.0E-11
sp|Q49V41|TRMHL_STAS1 Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP2224 PE=3 SV=1 356 518 4.0E-11
sp|Q88DE7|RLMB_PSEPK 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Pseudomonas putida (strain KT2440) GN=rlmB PE=3 SV=1 354 508 9.0E-11
sp|Q8Y016|RLMB_RALSO 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Ralstonia solanacearum (strain GMI1000) GN=rlmB PE=3 SV=1 342 508 9.0E-11
sp|Q87VK2|RLMB_PSESM 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rlmB PE=3 SV=1 354 520 1.0E-10
sp|Q9JUU8|RLMB_NEIMA 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rlmB PE=3 SV=2 347 515 3.0E-10
sp|B2HJ20|Y5079_MYCMM Uncharacterized tRNA/rRNA methyltransferase MMAR_5079 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_5079 PE=3 SV=1 351 518 3.0E-10
sp|A0PV26|Y4155_MYCUA Uncharacterized tRNA/rRNA methyltransferase MUL_4155 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_4155 PE=3 SV=1 351 518 4.0E-10
sp|Q6LM40|RLMB_PHOPR 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Photobacterium profundum GN=rlmB PE=3 SV=1 224 508 4.0E-10
sp|Q99W72|TRMHL_STAAM Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0531 PE=3 SV=1 356 518 9.0E-10
sp|Q9JZR3|RLMB_NEIMB 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Neisseria meningitidis serogroup B (strain MC58) GN=rlmB PE=3 SV=1 347 515 9.0E-10
sp|Q7A794|TRMHL_STAAN Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0490 PE=1 SV=1 356 518 9.0E-10
sp|Q6GJD7|TRMHL_STAAR Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0535 PE=3 SV=1 356 518 9.0E-10
sp|Q6GBV6|TRMHL_STAAS Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0489 PE=3 SV=1 356 518 9.0E-10
sp|Q7A1Q9|TRMHL_STAAW Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0487 PE=3 SV=1 356 518 9.0E-10
sp|Q743W2|Y479_MYCPA Uncharacterized tRNA/rRNA methyltransferase MAP_0479 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_0479 PE=3 SV=1 225 512 9.0E-10
sp|Q5HIE3|TRMHL_STAAC Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0578 PE=3 SV=1 356 518 9.0E-10
sp|Q9AGT0|TRMHL_STAAE Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0494 PE=3 SV=1 356 518 9.0E-10
sp|A1TG08|Y5337_MYCVP Uncharacterized tRNA/rRNA methyltransferase Mvan_5337 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_5337 PE=3 SV=1 224 518 1.0E-09
sp|Q9CCW4|Y324_MYCLE Uncharacterized tRNA/rRNA methyltransferase ML0324 OS=Mycobacterium leprae (strain TN) GN=ML0324 PE=3 SV=2 225 514 1.0E-09
sp|B8ZUB0|Y324_MYCLB Uncharacterized tRNA/rRNA methyltransferase MLBr00324 OS=Mycobacterium leprae (strain Br4923) GN=MLBr00324 PE=3 SV=2 225 514 1.0E-09
sp|Q7NYX3|RLMB_CHRVO 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rlmB PE=3 SV=1 335 515 1.0E-09
sp|Q7MH13|RLMB_VIBVY 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Vibrio vulnificus (strain YJ016) GN=rlmB PE=3 SV=1 224 511 2.0E-09
sp|Q8DCT8|RLMB_VIBVU 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Vibrio vulnificus (strain CMCP6) GN=rlmB PE=3 SV=1 224 511 2.0E-09
sp|Q5HRM1|TRMHL_STAEQ Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0172 PE=3 SV=1 356 512 1.0E-08
sp|Q8CTT9|TRMHL_STAES Putative TrmH family tRNA/rRNA methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0294 PE=3 SV=2 356 512 1.0E-08
sp|P94538|YSGA_BACSU Uncharacterized tRNA/rRNA methyltransferase YsgA OS=Bacillus subtilis (strain 168) GN=ysgA PE=3 SV=2 356 513 6.0E-08
sp|A1KPR5|Y3644_MYCBP Uncharacterized tRNA/rRNA methyltransferase BCG_3644c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_3644c PE=3 SV=1 352 516 7.0E-08
sp|P47494|Y252_MYCGE Uncharacterized tRNA/rRNA methyltransferase MG252 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG252 PE=3 SV=1 356 512 8.0E-08
sp|A5U8Q4|Y3618_MYCTA Uncharacterized tRNA/rRNA methyltransferase MRA_3618 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_3618 PE=3 SV=1 352 512 8.0E-08
sp|P9WFY5|Y3579_MYCTU Uncharacterized tRNA/rRNA methyltransferase Rv3579c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3579c PE=1 SV=1 352 512 8.0E-08
sp|P9WFY4|Y3579_MYCTO Uncharacterized tRNA/rRNA methyltransferase MT3685 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3685 PE=3 SV=1 352 512 8.0E-08
sp|Q9KNY2|RLMB_VIBCH 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmB PE=3 SV=1 224 508 9.0E-08
sp|Q83CW6|RLMB_COXBU 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rlmB PE=3 SV=1 225 508 2.0E-07
sp|B1MGY6|Y572_MYCA9 Uncharacterized tRNA/rRNA methyltransferase MAB_0572 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=MAB_0572 PE=3 SV=1 355 518 3.0E-07
sp|Q7TW55|Y3610_MYCBO Uncharacterized tRNA/rRNA methyltransferase Mb3610c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3610c PE=3 SV=1 352 516 4.0E-07
sp|P74261|Y1673_SYNY3 Uncharacterized tRNA/rRNA methyltransferase slr1673 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1673 PE=3 SV=1 351 515 1.0E-06
sp|P75424|Y355_MYCPN Uncharacterized tRNA/rRNA methyltransferase MG252 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_355 PE=3 SV=1 356 512 3.0E-06
sp|Q7VTK4|RLMB_BORPE 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rlmB PE=3 SV=1 350 521 4.0E-06
sp|Q7W7I7|RLMB_BORPA 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rlmB PE=3 SV=1 350 521 4.0E-06
sp|Q7WKX5|RLMB_BORBR 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rlmB PE=3 SV=1 350 521 4.0E-06
sp|A0R557|Y6073_MYCS2 Uncharacterized tRNA/rRNA methyltransferase MSMEG_6073/MSMEI_5913 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6073 PE=3 SV=1 355 518 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008173 RNA methyltransferase activity Yes
GO:0006396 RNA processing Yes
GO:0008168 methyltransferase activity Yes
GO:0003723 RNA binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5152
MALTEETQLNSATQPTGRTGLIMLAGLADEMVSTGKMRLNSATQLTVVTDLIGLIGVMVLTRERHLDKDTQLTGL
IGPISLAGLIDVVDPTEAMPLVGVMTSISMADLISLVALIDVVDPTESGGPDRRPGFDRGNARDGFDKRDARGRR
DGFDQDASDQRYATDRSDRNNGPDRRDRPDTSQLNLSYYTERRFPKIQPRLLEQASRGHGPLTEVKFSAAGSMFI
YGKNCVKAALRAGRRKLYKLYMLRDKRRDMTHDETIIHEMAVGRGILIANVQDVKRGMMDKMSGGRPHNGFVLEA
SQLPQKPLLSLCDIEDTANRLGFYVKLDHQSREDAEINGKENFIPRLTGISPKPFVVLLNHVVDPGNLGALVRSA
HYLGVDAIVMTDRHSASLDSCALKSSAGAAEEMTLFSVSSAADFIEQSKQHGWLSYAAVAPPSKSMLAKGAEAPI
SMQELEQADPLISHPCILVLGNEGQGIEPDIKAAVHQQVTIPSWRPSRTVDSLNVSVAGALLCQSFLKASQNSES
MVQAAAKRWSQGRAKKVQPPPWPQAPLPAESGDFGCIF*
Coding >Ophun1|5152
ATGGCTTTGACCGAAGAGACGCAGCTGAACAGCGCTACGCAACCAACCGGGCGAACGGGTCTGATCATGCTGGCG
GGTCTAGCCGACGAGATGGTTTCGACCGGAAAGATGCGCCTGAACAGCGCTACGCAACTGACCGTGGTGACCGAT
CTGATAGGCCTAATTGGCGTGATGGTTTTGACAAGAGAGAGACACCTGGACAAAGATACGCAACTGACCGGTCTG
ATCGGTCCGATCAGTCTGGCGGGCCTGATCGACGTCGTGGATCCGACCGAGGCGATGCCCCTGGTCGGCGTGATG
ACTTCAATCAGCATGGCCGATTTGATCAGTCTGGTGGCCCTGATAGACGTCGTGGATCCGACCGAGTCTGGTGGC
CCTGATAGACGTCCTGGATTCGACCGAGGCAATGCCCGTGATGGCTTCGATAAGCGTGATGCACGCGGTCGTCGT
GATGGCTTCGACCAAGATGCATCCGATCAACGATACGCAACTGACCGATCCGACCGCAACAATGGACCTGACCGA
CGAGATCGACCTGATACCTCGCAACTCAATCTCTCTTACTACACCGAGAGACGCTTCCCCAAGATCCAACCCCGT
CTCCTGGAGCAAGCCAGTCGGGGCCACGGCCCTCTGACCGAGGTCAAGTTCTCGGCAGCCGGATCCATGTTCATC
TATGGCAAGAACTGCGTCAAGGCGGCCCTTCGAGCGGGTCGACGAAAGCTATACAAGCTCTACATGCTGCGAGAC
AAGAGACGCGACATGACGCACGACGAGACGATTATTCACGAGATGGCGGTAGGGCGCGGCATCCTGATCGCCAAT
GTTCAGGACGTGAAACGCGGCATGATGGACAAGATGAGCGGTGGCCGACCTCACAATGGCTTCGTGCTCGAGGCG
TCACAGCTGCCGCAGAAGCCTCTCCTGAGTCTGTGTGACATCGAGGACACTGCCAACCGGCTGGGCTTCTACGTC
AAGCTGGATCACCAGTCGAGGGAGGACGCGGAGATTAACGGCAAGGAAAACTTCATACCGCGATTGACGGGCATC
TCGCCCAAGCCGTTCGTGGTGTTGCTCAACCACGTCGTCGACCCGGGCAACCTGGGAGCTCTGGTACGGTCGGCT
CATTACCTGGGCGTCGACGCCATCGTCATGACGGACAGACACTCGGCGTCGCTGGACTCGTGCGCGCTCAAGTCG
TCTGCGGGCGCGGCCGAGGAGATGACGCTCTTCTCCGTCTCTTCGGCAGCCGACTTTATCGAGCAGTCCAAGCAG
CACGGCTGGCTGTCATACGCAGCCGTGGCTCCCCCGAGCAAGTCGATGCTGGCAAAGGGCGCCGAGGCCCCGATC
AGCATGCAAGAGCTGGAACAGGCAGACCCTCTCATCAGCCATCCGTGTATCCTTGTGCTCGGCAACGAGGGACAG
GGCATCGAGCCGGACATCAAGGCAGCCGTCCACCAGCAGGTGACGATACCCAGCTGGCGGCCATCGCGAACCGTC
GACAGCCTCAACGTCAGCGTCGCGGGCGCGCTGCTGTGCCAGTCCTTCCTCAAGGCATCGCAGAACTCCGAGAGC
ATGGTTCAGGCGGCCGCCAAACGCTGGTCGCAGGGACGTGCCAAGAAGGTCCAGCCGCCGCCTTGGCCACAGGCA
CCGCTGCCGGCGGAGTCGGGCGATTTCGGCTGTATATTCTAA
Transcript >Ophun1|5152
ATGGCTTTGACCGAAGAGACGCAGCTGAACAGCGCTACGCAACCAACCGGGCGAACGGGTCTGATCATGCTGGCG
GGTCTAGCCGACGAGATGGTTTCGACCGGAAAGATGCGCCTGAACAGCGCTACGCAACTGACCGTGGTGACCGAT
CTGATAGGCCTAATTGGCGTGATGGTTTTGACAAGAGAGAGACACCTGGACAAAGATACGCAACTGACCGGTCTG
ATCGGTCCGATCAGTCTGGCGGGCCTGATCGACGTCGTGGATCCGACCGAGGCGATGCCCCTGGTCGGCGTGATG
ACTTCAATCAGCATGGCCGATTTGATCAGTCTGGTGGCCCTGATAGACGTCGTGGATCCGACCGAGTCTGGTGGC
CCTGATAGACGTCCTGGATTCGACCGAGGCAATGCCCGTGATGGCTTCGATAAGCGTGATGCACGCGGTCGTCGT
GATGGCTTCGACCAAGATGCATCCGATCAACGATACGCAACTGACCGATCCGACCGCAACAATGGACCTGACCGA
CGAGATCGACCTGATACCTCGCAACTCAATCTCTCTTACTACACCGAGAGACGCTTCCCCAAGATCCAACCCCGT
CTCCTGGAGCAAGCCAGTCGGGGCCACGGCCCTCTGACCGAGGTCAAGTTCTCGGCAGCCGGATCCATGTTCATC
TATGGCAAGAACTGCGTCAAGGCGGCCCTTCGAGCGGGTCGACGAAAGCTATACAAGCTCTACATGCTGCGAGAC
AAGAGACGCGACATGACGCACGACGAGACGATTATTCACGAGATGGCGGTAGGGCGCGGCATCCTGATCGCCAAT
GTTCAGGACGTGAAACGCGGCATGATGGACAAGATGAGCGGTGGCCGACCTCACAATGGCTTCGTGCTCGAGGCG
TCACAGCTGCCGCAGAAGCCTCTCCTGAGTCTGTGTGACATCGAGGACACTGCCAACCGGCTGGGCTTCTACGTC
AAGCTGGATCACCAGTCGAGGGAGGACGCGGAGATTAACGGCAAGGAAAACTTCATACCGCGATTGACGGGCATC
TCGCCCAAGCCGTTCGTGGTGTTGCTCAACCACGTCGTCGACCCGGGCAACCTGGGAGCTCTGGTACGGTCGGCT
CATTACCTGGGCGTCGACGCCATCGTCATGACGGACAGACACTCGGCGTCGCTGGACTCGTGCGCGCTCAAGTCG
TCTGCGGGCGCGGCCGAGGAGATGACGCTCTTCTCCGTCTCTTCGGCAGCCGACTTTATCGAGCAGTCCAAGCAG
CACGGCTGGCTGTCATACGCAGCCGTGGCTCCCCCGAGCAAGTCGATGCTGGCAAAGGGCGCCGAGGCCCCGATC
AGCATGCAAGAGCTGGAACAGGCAGACCCTCTCATCAGCCATCCGTGTATCCTTGTGCTCGGCAACGAGGGACAG
GGCATCGAGCCGGACATCAAGGCAGCCGTCCACCAGCAGGTGACGATACCCAGCTGGCGGCCATCGCGAACCGTC
GACAGCCTCAACGTCAGCGTCGCGGGCGCGCTGCTGTGCCAGTCCTTCCTCAAGGCATCGCAGAACTCCGAGAGC
ATGGTTCAGGCGGCCGCCAAACGCTGGTCGCAGGGACGTGCCAAGAAGGTCCAGCCGCCGCCTTGGCCACAGGCA
CCGCTGCCGGCGGAGTCGGGCGATTTCGGCTGTATATTCTAA
Gene >Ophun1|5152
ATGGCTTTGACCGAAGAGACGCAGCTGAACAGCGCTACGCAACCAACCGGGCGAACGGGTCTGATCATGCTGGCG
GGTCTAGCCGACGAGATGGTTTCGACCGGAAAGATGCGCCTGAACAGCGCTACGCAACTGACCGTGGTGACCGAT
CTGATAGGCCTAATTGGCGTGATGGTTTTGACAAGAGAGAGACACCTGGACAAAGATACGCAACTGACCGGTCTG
ATCGGTCCGATCAGTCTGGCGGGCCTGATCGACGTCGTGGATCCGACCGAGGCGATGCCCCTGGTCGGCGTGATG
ACTTCAATCAGCATGGCCGATTTGATCAGTCTGGTGGCCCTGATAGACGTCGTGGATCCGACCGAGGTGATGACC
CTGGACGGCGTGATGAGTTGAATTTTTTGAACCGATTTGATCAGTCTGGTGGCCCTGATAGACGTCCTGGATTCG
ACCGAGGCAATGCCCGTGATGGCTTCGATAAGCGTGATGCACGCGGTCGTCGTGATGGCTTCGACCAAGATGCAT
CCGATCAACGATACGCAACTGACCGATCCGACCGCAACAATGGACCTGACCGACGAGATCGACCTGATACCTCGC
AACTCAATCTCTCTTACTACACCGAGAGACGCTTCCCCAAGATCCAACCCCGTCTCCTGGAGCAAGCCAGTCGGG
GCCACGGCCCTCTGACCGAGGTCAAGTTCTCGGCAGCCGGATCCATGTTCATCTATGGCAAGAACTGCGTCAAGG
CGGCCCTTCGAGCGGGTCGACGAAAGCTATACAAGCTCTACATGCTGCGAGACAAGAGACGCGACATGACGCACG
ACGAGACGATTATTCACGAGATGGCGGTAGGGCGCGGCATCCTGATCGCCAATGTTCAGGACGTGAAACGCGGCA
TGATGGACAAGATGAGCGGTGGCCGACCTCACAATGGCTTCGTGCTCGAGGCGTCACAGCTGCCGCAGAAGCCTC
TCCTGAGTCTGTGTGACATCGAGGACACTGCCAACCGGCTGGGCTTCTACGTCAAGCTGGATCACCAGTCGAGGG
AGGACGCGGAGATTAACGGCAAGGAAAACTTCATACCGCGATTGACGGGCATCTCGCCCAAGCCGTTCGTGGTGT
TGCTCAACCACGTCGTCGACCCGGGCAACCTGGGAGCTCTGGTACGGTCGGCTCATTACCTGGGCGTCGACGCCA
TCGTCATGACGGACAGACACTCGGCGTCGCTGGACTCGTGCGCGCTCAAGTCGTCTGCGGGCGCGGCCGAGGAGA
TGACGCTCTTCTCCGTCTCTTCGGCAGCCGACTTTATCGAGCAGTCCAAGCAGCACGGCTGGCTGTCATACGCAG
CCGTGGCTCCCCCGAGCAAGTCGATGCTGGCAAAGGGCGCCGAGGCCCCGATCAGCATGCAAGAGCTGGAACAGG
CAGACCCTCTCATCAGCCATCCGTGTATCCTTGTGCTCGGCAACGAGGGACAGGGCATCGAGCCGGACATCAAGG
CAGCCGTCCACCAGCAGGTGACGATACCCAGCTGGCGGCCATCGCGAACCGTCGACAGCCTCAACGTCAGCGTCG
CGGGCGCGCTGCTGTGCCAGTCCTTCCTCAAGGCATCGCAGAACTCCGAGAGCATGGTTCAGGCGGCCGCCAAAC
GCTGGTCGCAGGGACGTGCCAAGAAGGTCCAGCCGCCGCCTTGGCCACAGGCACCGCTGCCGGCGGAGTCGGGCG
ATTTCGGCTGTATATTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail