Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5142
Gene name
LocationContig_498:11914..13976
Strand-
Gene length (bp)2062
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 9.5E-49 275 574
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.4E-22 275 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25333|HAL4_YEAST Serine/threonine-protein kinase HAL4/SAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAT4 PE=1 SV=1 272 581 4.0E-51
sp|O74526|KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.05c PE=1 SV=1 276 612 6.0E-45
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 272 581 1.0E-44
sp|O59763|OCA2_SCHPO Serine/threonine-protein kinase oca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca2 PE=1 SV=1 258 584 2.0E-44
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 275 583 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25333|HAL4_YEAST Serine/threonine-protein kinase HAL4/SAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAT4 PE=1 SV=1 272 581 4.0E-51
sp|O74526|KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.05c PE=1 SV=1 276 612 6.0E-45
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 272 581 1.0E-44
sp|O59763|OCA2_SCHPO Serine/threonine-protein kinase oca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca2 PE=1 SV=1 258 584 2.0E-44
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 275 583 4.0E-43
sp|Q12310|PRR2_YEAST Serine/threonine-protein kinase PRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR2 PE=1 SV=1 278 582 7.0E-43
sp|P22211|NPR1_YEAST Nitrogen permease reactivator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPR1 PE=1 SV=2 289 582 9.0E-42
sp|Q08732|HRK1_YEAST Serine/threonine-protein kinase HRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRK1 PE=1 SV=1 245 496 8.0E-40
sp|A6ZZF6|KKQ8_YEAS7 Probable serine/threonine-protein kinase KKQ8 OS=Saccharomyces cerevisiae (strain YJM789) GN=KKQ8 PE=3 SV=2 299 586 1.0E-36
sp|P36004|KKQ8_YEAST Probable serine/threonine-protein kinase KKQ8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KKQ8 PE=1 SV=2 299 586 1.0E-36
sp|Q6FJ85|KKQ8_CANGA Probable serine/threonine-protein kinase KKQ8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KKQ8 PE=3 SV=1 299 580 2.0E-34
sp|Q6CXN5|HAL5_KLULA Probable serine/threonine-protein kinase HAL5-like OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0A06820g PE=3 SV=1 278 580 5.0E-33
sp|A7TGR2|HAL5_VANPO Probable serine/threonine-protein kinase HAL5-like OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2001p30 PE=3 SV=1 275 580 6.0E-33
sp|Q757X8|HAL5_ASHGO Probable serine/threonine-protein kinase HAL5-like OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AEL118C PE=3 SV=1 298 580 8.0E-33
sp|O94647|PPK24_SCHPO Serine/threonine-protein kinase ppk24, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk24 PE=1 SV=1 265 586 2.0E-31
sp|Q6FQH2|HAL5_CANGA Serine/threonine-protein kinase HAL5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAL5 PE=3 SV=1 298 580 3.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 261 575 3.0E-31
sp|Q09792|PPK8_SCHPO Serine/threonine-protein kinase ppk8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk8 PE=3 SV=1 272 577 7.0E-31
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 275 575 2.0E-30
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 267 575 2.0E-30
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 270 576 1.0E-29
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 270 576 3.0E-29
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 270 576 7.0E-29
sp|A6ZQG7|HAL5_YEAS7 Serine/threonine-protein kinase HAL5 OS=Saccharomyces cerevisiae (strain YJM789) GN=HAL5 PE=3 SV=1 298 580 7.0E-29
sp|P38970|HAL5_YEAST Serine/threonine-protein kinase HAL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAL5 PE=1 SV=2 298 580 7.0E-29
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 250 575 9.0E-29
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 265 575 1.0E-28
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 270 575 1.0E-28
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 318 575 3.0E-28
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 275 575 3.0E-27
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 278 577 3.0E-27
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 275 575 3.0E-27
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 317 575 8.0E-27
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 256 575 1.0E-26
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 275 575 2.0E-26
sp|Q6FRE7|PTK2_CANGA Serine/threonine-protein kinase PTK2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PTK2 PE=3 SV=1 228 625 2.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 271 575 2.0E-26
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 275 575 2.0E-26
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 270 587 3.0E-26
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 278 573 3.0E-26
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 275 575 4.0E-26
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 275 575 4.0E-26
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 276 599 4.0E-26
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 276 599 4.0E-26
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 278 573 8.0E-26
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 275 576 1.0E-25
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 278 573 2.0E-25
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 270 579 3.0E-25
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 275 575 3.0E-25
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 278 573 4.0E-25
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 275 575 5.0E-25
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 261 574 9.0E-25
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 276 590 1.0E-24
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 276 590 1.0E-24
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 319 575 2.0E-24
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 318 589 2.0E-24
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 275 576 2.0E-24
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 275 575 2.0E-24
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 270 492 3.0E-24
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 311 574 3.0E-24
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 275 575 3.0E-24
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 311 574 4.0E-24
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 271 575 5.0E-24
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 270 575 6.0E-24
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 275 575 7.0E-24
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 276 590 9.0E-24
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 270 575 9.0E-24
sp|P47116|PTK2_YEAST Serine/threonine-protein kinase PTK2/STK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTK2 PE=1 SV=1 235 589 1.0E-23
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 275 575 2.0E-23
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 275 587 2.0E-23
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 275 594 2.0E-23
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 275 495 2.0E-23
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 319 575 3.0E-23
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 275 575 3.0E-23
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 275 575 5.0E-23
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 275 575 5.0E-23
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 273 492 5.0E-23
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 269 575 5.0E-23
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 273 492 6.0E-23
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 276 587 6.0E-23
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 276 587 7.0E-23
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 271 534 8.0E-23
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 276 574 8.0E-23
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 275 574 9.0E-23
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 273 492 1.0E-22
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 276 575 1.0E-22
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 276 492 1.0E-22
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 275 575 1.0E-22
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 315 598 2.0E-22
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 275 606 2.0E-22
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 315 575 2.0E-22
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 278 583 2.0E-22
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 275 579 2.0E-22
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 269 601 3.0E-22
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 275 575 3.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 203 578 3.0E-22
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 276 499 4.0E-22
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 264 492 4.0E-22
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 256 583 4.0E-22
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 269 575 4.0E-22
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 275 492 4.0E-22
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 275 575 4.0E-22
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 276 574 5.0E-22
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 276 574 5.0E-22
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 276 574 5.0E-22
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 278 492 5.0E-22
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 276 575 5.0E-22
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 276 575 5.0E-22
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 269 575 5.0E-22
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 278 574 6.0E-22
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 276 492 6.0E-22
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 270 576 7.0E-22
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 275 575 9.0E-22
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 320 576 9.0E-22
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 276 574 1.0E-21
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 256 583 1.0E-21
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 273 573 1.0E-21
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 273 573 1.0E-21
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 275 492 2.0E-21
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 278 507 2.0E-21
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 276 574 2.0E-21
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 318 579 2.0E-21
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 273 573 2.0E-21
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 275 575 2.0E-21
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 319 574 2.0E-21
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 318 575 2.0E-21
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 276 492 3.0E-21
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 264 574 3.0E-21
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 319 588 3.0E-21
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 258 575 3.0E-21
sp|P36002|PTK1_YEAST Serine/threonine-protein kinase PTK1/STK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTK1 PE=1 SV=3 228 598 3.0E-21
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 276 574 4.0E-21
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 264 492 4.0E-21
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 264 492 4.0E-21
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 259 576 4.0E-21
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 278 578 5.0E-21
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 271 559 6.0E-21
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 278 550 6.0E-21
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 253 576 6.0E-21
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 270 575 6.0E-21
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 275 575 7.0E-21
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 278 550 9.0E-21
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 275 578 9.0E-21
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 254 576 1.0E-20
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 317 575 1.0E-20
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 317 575 1.0E-20
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 320 575 1.0E-20
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 278 574 1.0E-20
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 278 550 1.0E-20
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 259 576 1.0E-20
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 317 575 1.0E-20
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 276 492 1.0E-20
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 275 575 1.0E-20
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 276 577 1.0E-20
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 317 575 1.0E-20
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 317 575 1.0E-20
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 318 575 1.0E-20
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 313 576 1.0E-20
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 276 575 2.0E-20
sp|P0C198|CHK1_USTMA Serine/threonine-protein kinase CHK1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHK1 PE=3 SV=1 351 575 2.0E-20
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 276 575 2.0E-20
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 267 574 3.0E-20
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 266 576 3.0E-20
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 275 573 3.0E-20
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 318 575 3.0E-20
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 267 574 3.0E-20
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 275 574 3.0E-20
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 275 576 3.0E-20
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 273 573 4.0E-20
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 270 584 4.0E-20
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 317 577 4.0E-20
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 267 574 4.0E-20
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 276 492 4.0E-20
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 276 492 4.0E-20
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 275 492 5.0E-20
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 275 500 6.0E-20
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 278 577 7.0E-20
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 273 493 7.0E-20
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 264 492 8.0E-20
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 276 574 8.0E-20
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 318 575 9.0E-20
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 296 575 9.0E-20
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 256 492 9.0E-20
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 269 492 9.0E-20
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 273 573 1.0E-19
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 275 500 1.0E-19
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 276 574 1.0E-19
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 275 575 1.0E-19
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 276 492 2.0E-19
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 276 574 2.0E-19
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 290 574 2.0E-19
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 278 574 2.0E-19
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 276 492 2.0E-19
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 259 574 2.0E-19
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 259 574 2.0E-19
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 276 576 2.0E-19
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 276 492 2.0E-19
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 270 565 2.0E-19
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 275 585 2.0E-19
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 318 574 2.0E-19
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 278 492 3.0E-19
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 275 575 3.0E-19
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 276 577 3.0E-19
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 266 578 3.0E-19
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 278 492 3.0E-19
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 319 587 3.0E-19
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 276 574 3.0E-19
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 275 576 3.0E-19
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 266 578 3.0E-19
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 255 574 4.0E-19
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 275 574 4.0E-19
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 275 576 4.0E-19
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 318 574 5.0E-19
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 263 499 5.0E-19
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 259 574 5.0E-19
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 275 573 6.0E-19
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 271 575 6.0E-19
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 275 574 7.0E-19
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 275 574 8.0E-19
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 317 573 8.0E-19
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 278 574 8.0E-19
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 256 576 8.0E-19
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 275 492 8.0E-19
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 266 578 8.0E-19
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 276 492 9.0E-19
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 275 573 9.0E-19
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 317 573 9.0E-19
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 320 499 1.0E-18
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 276 493 1.0E-18
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 278 574 1.0E-18
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 286 604 1.0E-18
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 278 597 1.0E-18
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 286 604 1.0E-18
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 286 575 1.0E-18
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 276 493 1.0E-18
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 276 579 2.0E-18
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 265 492 2.0E-18
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 318 606 2.0E-18
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 256 576 2.0E-18
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 318 606 2.0E-18
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 276 493 2.0E-18
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 256 576 2.0E-18
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 275 575 2.0E-18
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 276 493 2.0E-18
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 203 492 2.0E-18
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 275 576 2.0E-18
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 318 576 2.0E-18
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 275 606 3.0E-18
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 286 493 3.0E-18
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 275 576 3.0E-18
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 270 575 3.0E-18
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 277 583 3.0E-18
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 275 546 3.0E-18
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 296 576 3.0E-18
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 278 492 3.0E-18
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 263 492 4.0E-18
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 273 590 4.0E-18
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 275 573 4.0E-18
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 263 585 4.0E-18
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 318 576 4.0E-18
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 268 576 4.0E-18
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 276 580 4.0E-18
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 275 573 4.0E-18
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 275 570 4.0E-18
sp|Q91604|STK11_XENLA Serine/threonine-protein kinase stk11 OS=Xenopus laevis GN=stk11 PE=1 SV=1 317 575 4.0E-18
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 275 492 4.0E-18
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 275 490 4.0E-18
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 275 492 4.0E-18
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 276 577 4.0E-18
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 247 590 5.0E-18
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 286 493 5.0E-18
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 276 577 5.0E-18
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 318 576 6.0E-18
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 278 551 6.0E-18
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 276 577 6.0E-18
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 302 574 6.0E-18
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 278 492 7.0E-18
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 275 492 8.0E-18
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 275 576 8.0E-18
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 275 574 8.0E-18
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 318 606 9.0E-18
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 278 606 9.0E-18
sp|Q8SSA8|CHK1_ENCCU Probable serine/threonine-protein kinase CHK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHK1 PE=3 SV=1 323 511 9.0E-18
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 278 606 1.0E-17
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 257 491 1.0E-17
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 276 576 1.0E-17
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 275 576 1.0E-17
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 276 577 1.0E-17
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 276 492 1.0E-17
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 268 576 1.0E-17
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 268 576 1.0E-17
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 268 576 1.0E-17
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 276 577 1.0E-17
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 276 492 1.0E-17
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 318 574 1.0E-17
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 260 575 1.0E-17
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 275 574 2.0E-17
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 319 576 2.0E-17
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 275 574 2.0E-17
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 269 492 2.0E-17
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 276 574 2.0E-17
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 276 574 2.0E-17
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 275 575 3.0E-17
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 319 576 3.0E-17
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 319 581 3.0E-17
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 319 576 3.0E-17
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 319 576 3.0E-17
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 271 575 4.0E-17
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 288 575 4.0E-17
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 319 576 4.0E-17
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 288 575 4.0E-17
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 275 575 4.0E-17
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 273 492 4.0E-17
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 323 489 4.0E-17
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 258 574 4.0E-17
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 278 551 5.0E-17
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 278 574 5.0E-17
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 320 606 6.0E-17
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 208 527 6.0E-17
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 286 493 6.0E-17
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 248 574 6.0E-17
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 319 575 6.0E-17
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 320 576 6.0E-17
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 277 492 7.0E-17
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 328 576 8.0E-17
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 263 577 8.0E-17
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 276 492 8.0E-17
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 278 500 8.0E-17
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 302 493 9.0E-17
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 275 576 9.0E-17
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 297 599 1.0E-16
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 275 574 1.0E-16
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 296 577 1.0E-16
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 275 551 1.0E-16
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 275 493 1.0E-16
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 278 512 1.0E-16
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 277 492 1.0E-16
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 273 577 1.0E-16
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 297 599 1.0E-16
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 275 574 2.0E-16
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 275 551 2.0E-16
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 297 599 2.0E-16
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 297 599 2.0E-16
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 274 575 2.0E-16
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 317 575 2.0E-16
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 276 492 2.0E-16
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 275 492 2.0E-16
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 275 576 2.0E-16
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 269 575 2.0E-16
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 317 575 2.0E-16
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 320 576 2.0E-16
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 275 574 2.0E-16
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 263 577 2.0E-16
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 276 573 2.0E-16
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 276 503 2.0E-16
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 296 494 2.0E-16
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 278 512 2.0E-16
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 307 605 2.0E-16
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 275 493 3.0E-16
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 288 575 3.0E-16
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 275 576 3.0E-16
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 275 551 4.0E-16
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 286 577 4.0E-16
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 286 577 4.0E-16
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 323 489 4.0E-16
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 278 574 4.0E-16
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 278 511 4.0E-16
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 261 492 4.0E-16
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 276 563 4.0E-16
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 275 575 4.0E-16
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 276 575 4.0E-16
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 278 511 4.0E-16
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 276 492 4.0E-16
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 320 492 4.0E-16
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 270 536 5.0E-16
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 302 493 5.0E-16
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 276 575 5.0E-16
sp|Q54TH6|Y9863_DICDI Probable serine/threonine-protein kinase DDB_G0281745 OS=Dictyostelium discoideum GN=DDB_G0281745 PE=3 SV=1 258 489 5.0E-16
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 276 492 5.0E-16
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 275 575 6.0E-16
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 307 605 6.0E-16
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 275 575 6.0E-16
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 302 574 6.0E-16
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 276 492 6.0E-16
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 275 492 7.0E-16
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 278 527 7.0E-16
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 296 583 8.0E-16
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 285 492 8.0E-16
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 317 575 9.0E-16
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 317 575 9.0E-16
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 278 582 1.0E-15
sp|Q3ZDQ4|ATG1_PODAS Serine/threonine-protein kinase ATG1 OS=Podospora anserina GN=ATG1 PE=2 SV=1 276 492 1.0E-15
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 275 492 1.0E-15
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 275 578 1.0E-15
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 278 492 1.0E-15
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 278 574 1.0E-15
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 266 492 1.0E-15
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 296 583 1.0E-15
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 266 575 1.0E-15
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 278 539 1.0E-15
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 275 575 2.0E-15
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 278 574 2.0E-15
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 255 574 2.0E-15
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 299 492 2.0E-15
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 276 492 2.0E-15
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 276 492 2.0E-15
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 296 583 2.0E-15
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 320 492 2.0E-15
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 268 583 2.0E-15
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 276 568 2.0E-15
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 276 492 2.0E-15
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 278 460 2.0E-15
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 111 492 3.0E-15
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 276 492 3.0E-15
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 278 493 3.0E-15
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 275 576 3.0E-15
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 278 493 3.0E-15
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 265 486 3.0E-15
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 318 574 3.0E-15
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 278 492 3.0E-15
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 276 539 3.0E-15
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 275 575 3.0E-15
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 276 597 3.0E-15
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 278 493 3.0E-15
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 278 493 3.0E-15
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 278 577 4.0E-15
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 268 489 4.0E-15
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 275 493 4.0E-15
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 275 590 4.0E-15
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 278 492 4.0E-15
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 278 493 4.0E-15
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 276 492 4.0E-15
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 276 460 4.0E-15
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 278 492 4.0E-15
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 278 577 4.0E-15
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 276 492 4.0E-15
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 276 516 4.0E-15
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 275 575 4.0E-15
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 273 584 5.0E-15
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 273 500 5.0E-15
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 273 500 5.0E-15
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 275 574 5.0E-15
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 275 493 5.0E-15
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 273 492 5.0E-15
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 276 492 5.0E-15
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 275 574 5.0E-15
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 276 492 6.0E-15
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 278 589 6.0E-15
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 278 492 6.0E-15
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 275 506 6.0E-15
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 275 574 7.0E-15
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 278 575 7.0E-15
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 276 492 7.0E-15
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 317 575 7.0E-15
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 260 486 7.0E-15
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 276 492 7.0E-15
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 275 576 8.0E-15
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 278 605 8.0E-15
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 278 598 8.0E-15
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 278 574 8.0E-15
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 278 584 9.0E-15
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 320 569 9.0E-15
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 273 500 9.0E-15
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 278 598 9.0E-15
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 278 598 9.0E-15
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 318 574 9.0E-15
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 320 576 9.0E-15
sp|Q95QC4|DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans GN=zyg-8 PE=1 SV=1 278 577 9.0E-15
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 276 627 9.0E-15
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 318 574 1.0E-14
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 275 574 1.0E-14
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 273 569 1.0E-14
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 276 492 1.0E-14
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 276 492 1.0E-14
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 270 550 1.0E-14
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 255 541 1.0E-14
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 276 492 1.0E-14
sp|Q95YH0|CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum GN=cdk8 PE=2 SV=1 259 599 1.0E-14
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 268 573 1.0E-14
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 320 576 1.0E-14
sp|P28708|PRR1_YEAST Serine/threonine-protein kinase PRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR1 PE=1 SV=1 291 486 1.0E-14
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 273 492 1.0E-14
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 319 492 2.0E-14
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 263 575 2.0E-14
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 273 492 2.0E-14
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 276 516 2.0E-14
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 276 492 2.0E-14
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 276 492 2.0E-14
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 276 492 2.0E-14
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 285 539 2.0E-14
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 276 492 2.0E-14
sp|Q7SY49|CAMKV_DANRE CaM kinase-like vesicle-associated protein OS=Danio rerio GN=camkv PE=2 SV=2 297 494 2.0E-14
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 273 575 2.0E-14
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 278 493 2.0E-14
sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 318 597 3.0E-14
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 263 631 3.0E-14
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 261 492 3.0E-14
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 320 582 3.0E-14
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 275 577 3.0E-14
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 320 569 3.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 331 574 1.0E-11
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 278 578 1.0E-10
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 331 574 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|930
Ophiocordyceps australis map64 (Brazil) OphauB2|5149
Ophiocordyceps camponoti-floridani Ophcf2|06122
Ophiocordyceps camponoti-rufipedis Ophun1|5142 (this protein)
Ophiocordyceps kimflemingae Ophio5|6877
Ophiocordyceps subramaniannii Hirsu2|2373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5142
MTFSLAPSSYAPSSYPNLEEGADDSADSVVEPVTPSPKRIPTSDPPRLSDSDTAPPTPQSRRSNRKPAGRLRRTV
SSLFRRSNSREFVDVPPLPPPTSQPIVFGTRGLFDGSPASSSLNNDSPLSPGSPGSPSSPVMSPTNGSPVVGGRQ
FPSSDDFQKKGRAATGFSLRGRAVNFVGTRGRGSRHPSPARRASSFDGLTRPLNPGPAPKSSSSATPDAPRMFPP
ERLPWPLPPDAGTGVKARRMSLSLPDDFYIDVADLQSEYEYQHKILGRHGKHLGKGAASRVTLMVRKGCPGELYA
VKEFRGKSHRESQAEYEKKIKSEFSIGKSLHHPNIVETVRLCTNHHRWNHVMEYCSEGDLFGLVQKGHLKGEDKK
KDRQCLFKQLVQGVGYLHANGIAHRDIKLENLLLTKDSKLKITDFGVSEVFSGTHPGLREAGGQCGRNMGEIRLC
SPGICGSEPYIAPEVLEKRDRYDARALDVWSSAVVMIYMTFGGGIWSRAERGQPHYDKLVSGWNAWKRRHPEPGA
SISEDDYPKCLALDVGVNPPALRRLLLQMLNPDPRRRIAMAEVLTNRWMRNVECCQLESYDELVPTIDATKKEFA
NGTKKIFCHNHLPSKMAASHSLGKMPGQAGY*
Coding >Ophun1|5142
ATGACCTTCTCGCTGGCGCCCTCATCGTATGCGCCCTCATCGTATCCCAATCTCGAAGAGGGCGCCGATGATTCT
GCCGATTCCGTCGTCGAGCCCGTGACTCCAAGCCCCAAGAGGATTCCTACTTCGGATCCTCCTAGGCTTTCCGAT
TCTGATACGGCGCCTCCCACGCCTCAGTCCCGTCGCTCCAACCGAAAACCCGCCGGCCGCCTGCGACGCACCGTC
TCCAGCCTCTTCCGCCGCTCCAACTCGCGCGAGTTTGTCGACGTGCCTCCGCTGCCGCCACCCACCAGCCAGCCC
ATCGTCTTTGGAACCCGCGGCCTATTCGACGGCTCGCCCGCTTCGTCGAGTCTAAACAACGACTCGCCCCTCTCC
CCGGGCTCTCCCGGCTCTCCGTCGTCTCCCGTCATGTCGCCCACCAACGGCAGCCCCGTCGTCGGCGGTCGGCAG
TTCCCTTCGTCCGACGACTTCCAGAAGAAGGGTCGGGCCGCCACCGGCTTCTCCCTCCGTGGTCGGGCCGTCAAC
TTTGTCGGCACCAGGGGCCGTGGTTCTCGGCATCCCAGCCCGGCGCGACGCGCAAGCAGCTTCGACGGTCTCACC
CGGCCCCTCAACCCCGGTCCCGCTCCCAAGTCGTCCTCTTCGGCGACGCCCGACGCCCCCCGCATGTTCCCCCCC
GAGCGGCTTCCGTGGCCTCTTCCGCCCGATGCCGGTACCGGCGTCAAGGCCAGGCGCATGAGCCTCAGCCTGCCC
GACGACTTCTACATCGACGTGGCCGATCTACAGTCCGAGTACGAGTACCAGCACAAGATCCTCGGTCGGCACGGA
AAACACCTCGGCAAGGGCGCCGCCTCGCGGGTGACTCTCATGGTGCGGAAAGGCTGCCCCGGCGAGCTGTACGCC
GTCAAGGAGTTCCGCGGCAAGTCACATCGCGAGAGCCAGGCCGAGTACGAGAAGAAGATCAAGTCCGAGTTCAGC
ATCGGCAAGAGCCTGCACCACCCCAACATCGTCGAGACAGTTCGGCTGTGCACCAACCACCACCGGTGGAACCAC
GTGATGGAGTACTGCTCCGAGGGCGACCTGTTTGGCCTCGTGCAAAAGGGCCACCTCAAGGGCGAGGACAAGAAG
AAGGACAGGCAGTGCCTGTTCAAGCAGCTGGTGCAGGGCGTCGGCTACCTCCACGCCAACGGCATCGCCCACCGC
GACATCAAGCTGGAAAACCTGCTCTTGACCAAGGACAGCAAGCTCAAGATTACCGACTTCGGCGTGTCCGAGGTG
TTTTCCGGCACGCACCCGGGCCTACGCGAGGCGGGCGGTCAGTGCGGGCGCAACATGGGCGAGATCCGGCTATGC
TCGCCCGGCATCTGCGGCAGCGAGCCCTACATCGCGCCCGAGGTGCTGGAGAAGCGTGACCGGTACGACGCGAGG
GCCCTCGACGTGTGGAGCTCAGCCGTCGTCATGATCTACATGACGTTTGGAGGCGGCATCTGGTCTCGGGCCGAG
CGCGGACAGCCTCACTACGATAAGCTGGTATCCGGCTGGAACGCCTGGAAGCGACGACACCCGGAGCCCGGAGCG
TCCATCAGCGAAGACGACTATCCCAAGTGTCTGGCCCTCGACGTGGGCGTCAACCCCCCGGCCCTAAGGCGACTA
CTGCTGCAGATGCTCAACCCTGATCCCAGAAGGCGCATCGCAATGGCCGAGGTGCTGACCAACCGATGGATGCGC
AACGTCGAGTGCTGCCAGCTGGAATCCTACGACGAGCTGGTGCCCACCATCGACGCCACCAAGAAGGAGTTTGCC
AACGGCACCAAGAAGATCTTTTGCCACAACCATCTTCCCTCCAAGATGGCGGCCTCTCACTCGCTGGGCAAGATG
CCGGGACAGGCGGGATATTGA
Transcript >Ophun1|5142
ATGACCTTCTCGCTGGCGCCCTCATCGTATGCGCCCTCATCGTATCCCAATCTCGAAGAGGGCGCCGATGATTCT
GCCGATTCCGTCGTCGAGCCCGTGACTCCAAGCCCCAAGAGGATTCCTACTTCGGATCCTCCTAGGCTTTCCGAT
TCTGATACGGCGCCTCCCACGCCTCAGTCCCGTCGCTCCAACCGAAAACCCGCCGGCCGCCTGCGACGCACCGTC
TCCAGCCTCTTCCGCCGCTCCAACTCGCGCGAGTTTGTCGACGTGCCTCCGCTGCCGCCACCCACCAGCCAGCCC
ATCGTCTTTGGAACCCGCGGCCTATTCGACGGCTCGCCCGCTTCGTCGAGTCTAAACAACGACTCGCCCCTCTCC
CCGGGCTCTCCCGGCTCTCCGTCGTCTCCCGTCATGTCGCCCACCAACGGCAGCCCCGTCGTCGGCGGTCGGCAG
TTCCCTTCGTCCGACGACTTCCAGAAGAAGGGTCGGGCCGCCACCGGCTTCTCCCTCCGTGGTCGGGCCGTCAAC
TTTGTCGGCACCAGGGGCCGTGGTTCTCGGCATCCCAGCCCGGCGCGACGCGCAAGCAGCTTCGACGGTCTCACC
CGGCCCCTCAACCCCGGTCCCGCTCCCAAGTCGTCCTCTTCGGCGACGCCCGACGCCCCCCGCATGTTCCCCCCC
GAGCGGCTTCCGTGGCCTCTTCCGCCCGATGCCGGTACCGGCGTCAAGGCCAGGCGCATGAGCCTCAGCCTGCCC
GACGACTTCTACATCGACGTGGCCGATCTACAGTCCGAGTACGAGTACCAGCACAAGATCCTCGGTCGGCACGGA
AAACACCTCGGCAAGGGCGCCGCCTCGCGGGTGACTCTCATGGTGCGGAAAGGCTGCCCCGGCGAGCTGTACGCC
GTCAAGGAGTTCCGCGGCAAGTCACATCGCGAGAGCCAGGCCGAGTACGAGAAGAAGATCAAGTCCGAGTTCAGC
ATCGGCAAGAGCCTGCACCACCCCAACATCGTCGAGACAGTTCGGCTGTGCACCAACCACCACCGGTGGAACCAC
GTGATGGAGTACTGCTCCGAGGGCGACCTGTTTGGCCTCGTGCAAAAGGGCCACCTCAAGGGCGAGGACAAGAAG
AAGGACAGGCAGTGCCTGTTCAAGCAGCTGGTGCAGGGCGTCGGCTACCTCCACGCCAACGGCATCGCCCACCGC
GACATCAAGCTGGAAAACCTGCTCTTGACCAAGGACAGCAAGCTCAAGATTACCGACTTCGGCGTGTCCGAGGTG
TTTTCCGGCACGCACCCGGGCCTACGCGAGGCGGGCGGTCAGTGCGGGCGCAACATGGGCGAGATCCGGCTATGC
TCGCCCGGCATCTGCGGCAGCGAGCCCTACATCGCGCCCGAGGTGCTGGAGAAGCGTGACCGGTACGACGCGAGG
GCCCTCGACGTGTGGAGCTCAGCCGTCGTCATGATCTACATGACGTTTGGAGGCGGCATCTGGTCTCGGGCCGAG
CGCGGACAGCCTCACTACGATAAGCTGGTATCCGGCTGGAACGCCTGGAAGCGACGACACCCGGAGCCCGGAGCG
TCCATCAGCGAAGACGACTATCCCAAGTGTCTGGCCCTCGACGTGGGCGTCAACCCCCCGGCCCTAAGGCGACTA
CTGCTGCAGATGCTCAACCCTGATCCCAGAAGGCGCATCGCAATGGCCGAGGTGCTGACCAACCGATGGATGCGC
AACGTCGAGTGCTGCCAGCTGGAATCCTACGACGAGCTGGTGCCCACCATCGACGCCACCAAGAAGGAGTTTGCC
AACGGCACCAAGAAGATCTTTTGCCACAACCATCTTCCCTCCAAGATGGCGGCCTCTCACTCGCTGGGCAAGATG
CCGGGACAGGCGGGATATTGA
Gene >Ophun1|5142
ATGACGTGATTGTTGCTGACACACGGCAGGCGCCTCCTCGTGCCAGACGGCGACGCGCCCCAACGTCGGAGCCAT
AGCCATTGCTTCGCCCAGCTTCTCGCTGGCGCCCTCATCGTATGCGCCCTCATCGTATCCCAATCTCGAAGAGGG
CGCCGATGATTCTGCCGATTCCGTCGTCGAGCCCGTGACTCCAGTCAGTTGCGACGGCTGCTCTCACCACTTCAC
CGACGCTGAACACACCGTCTCTCGCTCATCCTCTTCGACCCCAAAGAGCCCCAAGAGGATTCCTACTTCGGATCC
TCCTAGGCTTTCCGATTCTGATACGGCGCCTCCCACGCCTCAGTCCCGTCGCTCCAACCGAAAACCCGCCGGCCG
CCTGCGACGCACCGTCTCCAGCCTCTTCCGCCGCTCCAACTCGCGCGAGTTTGTCGACGTGCCTCCGCTGCCGCC
ACCCACCAGCCAGCCCATCGTCTTTGGAACCCGCGGCCTATTCGACGGCTCGCCCGCTTCGTCGAGTCTAAACAA
CGACTCGCCCCTCTCCCCGGGCTCTCCCGGCTCTCCGTCGTCTCCCGTCATGTCGCCCACCAACGGCAGCCCCGT
CGTCGGCGGTCGGCAGTTCCCTTCGTCCGACGACTTCCAGAAGAAGGGTCGGGCCGCCACCGGCTTCTCCCTCCG
TGGTCGGGCCGTCAACTTTGTCGGCACCAGGGGCCGTGGTTCTCGGCATCCCAGCCCGGCGCGACGCGCAAGCAG
CTTCGACGGTCTCACCCGGCCCCTCAACCCCGGTCCCGCTCCCAAGTCGTCCTCTTCGGCGACGCCCGACGCCCC
CCGCATGTTCCCCCCCGAGCGGCTTCCGTGGCCTCTTCCGCCCGATGCCGGTACCGGCGTCAAGGCCAGGCGCAT
GAGCCTCAGCCTGCCCGACGACTTCTACATCGACGTGGCCGATCTACAGTCCGAGTACGAGTACCAGCACAAGAT
CCTCGGTCGGCACGGAAAACACCTCGGCAAGGGCGCCGCCTCGCGGGTGACTCTCATGGTGCGGAAAGGCTGCCC
CGGCGAGCTGTACGCCGTCAAGGAGTTCCGCGGCAAGTCACATCGCGAGAGCCAGGCCGAGTACGAGAAGAAGAT
CAAGTCCGAGTTCAGCATCGGCAAGAGCCTGCACCACCCCAACATCGTCGAGACAGTTCGGCTGTGCACCAACCA
CCACCGGTGGAACCACGTGATGGAGTACTGCTCCGAGGGCGACCTGTTTGGCCTCGTGCAAAAGGGCCACCTCAA
GGGCGAGGACAAGAAGAAGGACAGGCAGTGCCTGTTCAAGCAGCTGGTGCAGGGCGTCGGCTACCTCCACGCCAA
CGGCATCGCCCACCGCGACATCAAGCTGGAAAACCTGCTCTTGACCAAGGACAGCAAGCTCAAGATTACCGACTT
CGGCGTGTCCGAGGTGTTTTCCGGCACGCACCCGGGCCTACGCGAGGCGGGCGGTCAGTGCGGGCGCAACATGGG
CGAGATCCGGCTATGCTCGCCCGGCATCTGCGGCAGCGAGCCCTACATCGCGCCCGAGGTGCTGGAGAAGCGTGA
CCGGTACGACGCGAGGGCCCTCGACGTGTGGAGCTCAGCCGTCGTCATGATCTACATGACGTTTGGAGGCGGCAT
CTGGTCTCGGGCCGAGCGCGGACAGCCTCACTACGATAAGCTGGTATCCGGCTGGAACGCCTGGAAGCGACGACA
CCCGGAGCCCGGAGCGTCCATCAGCGAAGACGACTATCCCAAGTGTCTGGCCCTCGACGTGGGCGTCAACCCCCC
GGCCCTAAGGCGACTACTGCTGCAGATGCTCAACCCTGATCCCAGAAGGCGCATCGCAATGGCCGAGGTGCTGAC
CAACCGATGGATGCGCAACGTCGAGTGCTGCCAGCTGGAATCCTACGACGAGCTGGTGCCCACCATCGACGCCAC
CAAGAAGGAGTTTGCCAACGGCACCAAGAAGATCTTTTGCCACAACCATCTTCCCTCCAAGATGGCGGCCTCTCA
CTCGCTGGGCAAGATGCCGGGACAGGCGGGATATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail