Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5139
Gene name
LocationContig_498:3992..7674
Strand+
Gene length (bp)3682
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08506 Cse1 Cse1 6.3E-07 368 469
PF03810 IBN_N Importin-beta N-terminal domain 1.4E-04 76 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 12 1053 0.0E+00
sp|P46970|NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD5 PE=1 SV=2 1 1044 3.0E-112
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 78 1053 2.0E-109
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 78 1053 4.0E-109
sp|F4IRR2|SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana GN=SAD2 PE=1 SV=1 77 888 1.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 12 1053 0.0E+00
sp|P46970|NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD5 PE=1 SV=2 1 1044 3.0E-112
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 78 1053 2.0E-109
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 78 1053 4.0E-109
sp|F4IRR2|SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana GN=SAD2 PE=1 SV=1 77 888 1.0E-107
sp|F4J738|SAD2H_ARATH Importin beta-like SAD2 homolog OS=Arabidopsis thaliana GN=At3g59020 PE=1 SV=1 78 906 3.0E-103
sp|O15397|IPO8_HUMAN Importin-8 OS=Homo sapiens GN=IPO8 PE=1 SV=2 78 1047 4.0E-99
sp|Q7TMY7|IPO8_MOUSE Importin-8 OS=Mus musculus GN=Ipo8 PE=1 SV=3 78 923 2.0E-98
sp|Q55CX9|IPO7_DICDI Probable importin-7 homolog OS=Dictyostelium discoideum GN=DDB_G0269860 PE=3 SV=1 80 1007 2.0E-93
sp|Q04175|SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SXM1 PE=1 SV=1 72 917 7.0E-83
sp|Q8SR54|IMPO_ENCCU Probable importin ECU10_0620 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0620 PE=1 SV=1 360 923 3.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0019899 enzyme binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0005515 protein binding No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0051020 GTPase binding No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5139
MDSAAVRGLLVASLDADADNRRRAELQLKQCPTIEYVLPLPVPLPDPLIVTLPVPVFVSFPDSPPLSSVPLLTWS
LLAVIYIKNRVTRSWFPSEHSAEKPISEEEKIRIRDILVPILASSDGPVQQQLVPVLQRILQCDFPARWPRFIEF
TMELINTNSPRSVHAGLQCLLALCRAFRYKSSDAQDRLQFDSIVETSFSRLVVICNELVTQESDEAGEMLHLALK
AFKHATWLELSPYLRQRQVNIAWCTVFLQTVAKATPASALQGDQFDREKHHWWKAKKWAYFNLNRLFIRHGNPAS
PGKGAEAAQFANDFATTIAPEILKHYLQEIEKWVAKTSWLSRPCLSYTLVFLDESVRPKEMWTHLKPHLTNLVTH
FVFPVLCLTSDDVEQFEEEPEEYLHRKLNYFEEASAPDVAATNFLVNLTKNRRKETFEILKFVNAVVNEYEQSAD
DKKNHIAKEGALRMIGTLAPVILSKKSPIADQVEYFLVRYVFPDFTSGQGYLRARACDTIEKFEQLNFQDQGNLL
TIYRHILDCMADPALPVRVTASLALQPLIRHDLIRTSMQQSIPTIMQQLLKLANEVDIDALANVMEDFVEVFAAE
LTPFAVALCEQLRDTYLRIVRELLEKESRAGEDGDAYVDYDDKSITALGVLQTIGTLILTLESTPDVLLVIEAVL
MPVIKITLENKLYDLYNEVFEIIDSCTFAAKSISANMWQAFELIHTTFKAGAQYYLEDMLPALDNFVQYGVPQLA
QKPQYVQALYSMVADMFSDTVQGPVERICACKLSEAMMLSLRGHIDSCVEGFIVMTMNILAEEEVANRSYKIHLM
EMVINSIYYNPLLALQVLENKGWTNRFFSLWFGSMPAFSRVHDKKLCIVAISALLSVNHDQVPASVSVGWPRLLQ
GITELFRTLPIAMKNREEALRDDFHLESTYDYGDEDEWGDEDANWNGEEEPAQEEAAEAKDESKAYLEFLNDEAQ
KFSRGVETGDDDDLGEDSVPLESPLDRVEPYQSFKSVMMRMQQEQPQFYASLAGHLSAEDQNMIQTIMNKADEIA
AANAQLLAAQQVAHNANT*
Coding >Ophun1|5139
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTCGCCAGCTTGGATGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTCAAGCAGTGTCCGACTATCGAGTATGTCCTGCCGCTGCCCGTCCCGCTGCCCGATCCCCTGATTGTC
ACTCTCCCCGTGCCTGTCTTCGTCTCGTTCCCCGACTCGCCACCTCTCTCGTCCGTCCCGCTGCTGACCTGGTCC
CTGCTAGCCGTTATATACATCAAAAACCGCGTCACTCGCTCTTGGTTCCCATCGGAGCACAGCGCCGAGAAACCG
ATATCCGAGGAAGAAAAGATTCGCATTCGCGACATTCTCGTCCCCATACTGGCATCGTCCGATGGCCCTGTTCAG
CAGCAGCTCGTCCCCGTCCTTCAGCGGATCCTCCAATGCGACTTTCCCGCTCGCTGGCCGCGCTTCATCGAGTTC
ACCATGGAGCTCATCAATACAAACAGCCCGCGATCCGTCCACGCAGGCCTTCAATGCTTGCTCGCCCTCTGCCGC
GCATTCCGCTACAAGTCGAGCGACGCCCAAGATAGGCTGCAATTCGACTCCATCGTCGAGACGAGCTTCTCCCGT
CTCGTCGTCATCTGCAACGAGCTGGTGACACAGGAGAGTGACGAGGCTGGCGAGATGCTGCACCTCGCCCTCAAA
GCTTTTAAACATGCGACATGGCTCGAGCTGTCTCCCTACCTCCGGCAGCGTCAGGTCAACATTGCCTGGTGCACC
GTCTTCCTCCAAACCGTCGCCAAGGCGACCCCTGCGAGCGCCTTGCAAGGCGATCAGTTCGACCGAGAGAAGCAT
CACTGGTGGAAAGCCAAGAAGTGGGCCTATTTTAACTTGAACCGCCTCTTTATCAGGCACGGCAACCCGGCATCG
CCCGGCAAGGGGGCCGAGGCCGCCCAGTTCGCCAACGATTTCGCCACCACCATCGCGCCCGAGATCCTCAAGCAC
TATCTCCAAGAGATCGAGAAATGGGTGGCCAAGACGTCTTGGCTCAGCCGGCCCTGCCTCTCCTATACGCTCGTC
TTCCTCGACGAGTCTGTACGGCCCAAGGAGATGTGGACTCATCTCAAGCCGCATCTGACCAATCTCGTCACTCAC
TTTGTCTTTCCAGTGCTGTGCCTGACGTCAGACGACGTTGAACAGTTCGAGGAAGAGCCGGAGGAGTATCTACAC
CGCAAGCTCAACTACTTCGAGGAGGCCTCGGCCCCGGACGTGGCCGCCACGAATTTCCTCGTCAACCTGACCAAG
AACCGGCGCAAGGAGACGTTTGAGATTCTCAAGTTTGTCAATGCCGTCGTCAACGAGTACGAGCAGTCGGCCGAC
GACAAGAAGAACCACATCGCCAAGGAGGGCGCGCTGAGAATGATAGGCACACTCGCGCCCGTCATCCTCAGCAAG
AAGAGCCCCATCGCCGACCAGGTCGAATACTTTCTGGTGCGCTACGTCTTTCCCGATTTCACCAGCGGACAGGGT
TACTTGCGAGCCAGAGCTTGCGACACGATCGAGAAGTTCGAGCAGCTCAACTTCCAAGACCAGGGCAATCTTTTG
ACCATCTACCGGCACATCCTCGACTGCATGGCCGATCCGGCGCTGCCTGTGCGCGTCACGGCCTCTCTGGCTCTA
CAGCCCTTGATCCGGCACGACCTGATACGCACGAGTATGCAGCAGAGCATCCCGACCATCATGCAGCAGCTGCTC
AAGCTGGCCAACGAGGTCGACATTGACGCGCTGGCCAACGTCATGGAGGACTTTGTCGAGGTCTTCGCGGCGGAG
CTCACGCCCTTTGCCGTCGCCCTCTGCGAGCAGCTTCGCGATACCTACCTCCGCATCGTGCGGGAGCTCCTCGAG
AAGGAGAGCCGGGCGGGCGAGGACGGCGACGCCTACGTCGATTACGACGATAAGAGCATCACGGCGCTTGGCGTC
TTGCAGACGATTGGGACCTTGATTCTCACGCTGGAGAGCACGCCCGATGTTTTACTCGTAATCGAGGCGGTGCTG
ATGCCCGTCATTAAGATTACGTTGGAGAACAAGCTATACGATCTATACAACGAGGTTTTCGAAATCATCGACAGC
TGCACCTTTGCCGCCAAGAGCATCTCGGCCAACATGTGGCAGGCCTTTGAGCTGATCCACACGACGTTCAAGGCC
GGGGCGCAGTACTATCTCGAAGACATGCTGCCGGCGCTCGACAACTTTGTGCAATACGGCGTTCCGCAGCTGGCG
CAGAAGCCGCAATACGTGCAGGCGCTCTATTCGATGGTGGCCGACATGTTTTCCGACACGGTTCAGGGGCCCGTG
GAGCGCATCTGCGCATGCAAGCTGTCCGAGGCGATGATGCTGAGCCTCCGGGGCCACATTGACAGCTGCGTCGAG
GGCTTTATCGTCATGACGATGAACATCCTGGCCGAAGAAGAGGTGGCGAACAGGAGCTACAAGATCCACTTGATG
GAGATGGTCATCAACTCCATCTACTACAACCCCCTGCTGGCGCTGCAGGTGCTGGAGAACAAGGGCTGGACAAAT
AGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCTTTTAGTCGGGTCCACGACAAGAAGCTGTGCATCGTGGCC
ATCTCGGCGCTCCTGAGTGTCAACCACGACCAGGTACCGGCCAGCGTCTCCGTCGGGTGGCCGCGGCTGCTCCAG
GGTATCACGGAGCTGTTCCGGACGTTGCCCATTGCCATGAAGAATCGCGAAGAGGCTCTACGCGACGACTTCCAC
CTCGAATCTACGTATGACTACGGCGACGAGGACGAGTGGGGCGACGAGGATGCCAACTGGAACGGCGAGGAGGAG
CCCGCGCAGGAGGAGGCGGCGGAGGCGAAGGATGAGAGCAAGGCCTATCTGGAGTTTCTCAACGACGAGGCGCAA
AAGTTTAGCCGCGGCGTCGAGACGGGCGACGACGACGACTTGGGCGAGGACAGTGTGCCGCTCGAGTCACCGCTG
GACAGGGTGGAGCCCTATCAGTCGTTCAAGTCGGTCATGATGAGGATGCAACAGGAGCAGCCGCAGTTCTACGCC
AGCCTGGCGGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCATCATGAACAAGGCGGACGAAATCGCG
GCCGCGAATGCGCAGCTGTTGGCGGCTCAGCAAGTCGCTCACAATGCCAACACTTAG
Transcript >Ophun1|5139
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTCGCCAGCTTGGATGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTCAAGCAGTGTCCGACTATCGAGTATGTCCTGCCGCTGCCCGTCCCGCTGCCCGATCCCCTGATTGTC
ACTCTCCCCGTGCCTGTCTTCGTCTCGTTCCCCGACTCGCCACCTCTCTCGTCCGTCCCGCTGCTGACCTGGTCC
CTGCTAGCCGTTATATACATCAAAAACCGCGTCACTCGCTCTTGGTTCCCATCGGAGCACAGCGCCGAGAAACCG
ATATCCGAGGAAGAAAAGATTCGCATTCGCGACATTCTCGTCCCCATACTGGCATCGTCCGATGGCCCTGTTCAG
CAGCAGCTCGTCCCCGTCCTTCAGCGGATCCTCCAATGCGACTTTCCCGCTCGCTGGCCGCGCTTCATCGAGTTC
ACCATGGAGCTCATCAATACAAACAGCCCGCGATCCGTCCACGCAGGCCTTCAATGCTTGCTCGCCCTCTGCCGC
GCATTCCGCTACAAGTCGAGCGACGCCCAAGATAGGCTGCAATTCGACTCCATCGTCGAGACGAGCTTCTCCCGT
CTCGTCGTCATCTGCAACGAGCTGGTGACACAGGAGAGTGACGAGGCTGGCGAGATGCTGCACCTCGCCCTCAAA
GCTTTTAAACATGCGACATGGCTCGAGCTGTCTCCCTACCTCCGGCAGCGTCAGGTCAACATTGCCTGGTGCACC
GTCTTCCTCCAAACCGTCGCCAAGGCGACCCCTGCGAGCGCCTTGCAAGGCGATCAGTTCGACCGAGAGAAGCAT
CACTGGTGGAAAGCCAAGAAGTGGGCCTATTTTAACTTGAACCGCCTCTTTATCAGGCACGGCAACCCGGCATCG
CCCGGCAAGGGGGCCGAGGCCGCCCAGTTCGCCAACGATTTCGCCACCACCATCGCGCCCGAGATCCTCAAGCAC
TATCTCCAAGAGATCGAGAAATGGGTGGCCAAGACGTCTTGGCTCAGCCGGCCCTGCCTCTCCTATACGCTCGTC
TTCCTCGACGAGTCTGTACGGCCCAAGGAGATGTGGACTCATCTCAAGCCGCATCTGACCAATCTCGTCACTCAC
TTTGTCTTTCCAGTGCTGTGCCTGACGTCAGACGACGTTGAACAGTTCGAGGAAGAGCCGGAGGAGTATCTACAC
CGCAAGCTCAACTACTTCGAGGAGGCCTCGGCCCCGGACGTGGCCGCCACGAATTTCCTCGTCAACCTGACCAAG
AACCGGCGCAAGGAGACGTTTGAGATTCTCAAGTTTGTCAATGCCGTCGTCAACGAGTACGAGCAGTCGGCCGAC
GACAAGAAGAACCACATCGCCAAGGAGGGCGCGCTGAGAATGATAGGCACACTCGCGCCCGTCATCCTCAGCAAG
AAGAGCCCCATCGCCGACCAGGTCGAATACTTTCTGGTGCGCTACGTCTTTCCCGATTTCACCAGCGGACAGGGT
TACTTGCGAGCCAGAGCTTGCGACACGATCGAGAAGTTCGAGCAGCTCAACTTCCAAGACCAGGGCAATCTTTTG
ACCATCTACCGGCACATCCTCGACTGCATGGCCGATCCGGCGCTGCCTGTGCGCGTCACGGCCTCTCTGGCTCTA
CAGCCCTTGATCCGGCACGACCTGATACGCACGAGTATGCAGCAGAGCATCCCGACCATCATGCAGCAGCTGCTC
AAGCTGGCCAACGAGGTCGACATTGACGCGCTGGCCAACGTCATGGAGGACTTTGTCGAGGTCTTCGCGGCGGAG
CTCACGCCCTTTGCCGTCGCCCTCTGCGAGCAGCTTCGCGATACCTACCTCCGCATCGTGCGGGAGCTCCTCGAG
AAGGAGAGCCGGGCGGGCGAGGACGGCGACGCCTACGTCGATTACGACGATAAGAGCATCACGGCGCTTGGCGTC
TTGCAGACGATTGGGACCTTGATTCTCACGCTGGAGAGCACGCCCGATGTTTTACTCGTAATCGAGGCGGTGCTG
ATGCCCGTCATTAAGATTACGTTGGAGAACAAGCTATACGATCTATACAACGAGGTTTTCGAAATCATCGACAGC
TGCACCTTTGCCGCCAAGAGCATCTCGGCCAACATGTGGCAGGCCTTTGAGCTGATCCACACGACGTTCAAGGCC
GGGGCGCAGTACTATCTCGAAGACATGCTGCCGGCGCTCGACAACTTTGTGCAATACGGCGTTCCGCAGCTGGCG
CAGAAGCCGCAATACGTGCAGGCGCTCTATTCGATGGTGGCCGACATGTTTTCCGACACGGTTCAGGGGCCCGTG
GAGCGCATCTGCGCATGCAAGCTGTCCGAGGCGATGATGCTGAGCCTCCGGGGCCACATTGACAGCTGCGTCGAG
GGCTTTATCGTCATGACGATGAACATCCTGGCCGAAGAAGAGGTGGCGAACAGGAGCTACAAGATCCACTTGATG
GAGATGGTCATCAACTCCATCTACTACAACCCCCTGCTGGCGCTGCAGGTGCTGGAGAACAAGGGCTGGACAAAT
AGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCTTTTAGTCGGGTCCACGACAAGAAGCTGTGCATCGTGGCC
ATCTCGGCGCTCCTGAGTGTCAACCACGACCAGGTACCGGCCAGCGTCTCCGTCGGGTGGCCGCGGCTGCTCCAG
GGTATCACGGAGCTGTTCCGGACGTTGCCCATTGCCATGAAGAATCGCGAAGAGGCTCTACGCGACGACTTCCAC
CTCGAATCTACGTATGACTACGGCGACGAGGACGAGTGGGGCGACGAGGATGCCAACTGGAACGGCGAGGAGGAG
CCCGCGCAGGAGGAGGCGGCGGAGGCGAAGGATGAGAGCAAGGCCTATCTGGAGTTTCTCAACGACGAGGCGCAA
AAGTTTAGCCGCGGCGTCGAGACGGGCGACGACGACGACTTGGGCGAGGACAGTGTGCCGCTCGAGTCACCGCTG
GACAGGGTGGAGCCCTATCAGTCGTTCAAGTCGGTCATGATGAGGATGCAACAGGAGCAGCCGCAGTTCTACGCC
AGCCTGGCGGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCATCATGAACAAGGCGGACGAAATCGCG
GCCGCGAATGCGCAGCTGTTGGCGGCTCAGCAAGTCGCTCACAATGCCAACACTTAG
Gene >Ophun1|5139
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTCGCCAGCTTGGATGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTCAAGCAGGTTGGTTTCGTCTGTTCTGCCTGAGCTTGTGGTAGTGGCTGACGTTGCGTCGATATTAGG
TGGAAGAGCATACCGGATTTATCGAATGTCTTTTTCAGATATTACAGGCCGAGCATGATGCTAGTGTCCGACTAT
CGAGTATGTCCTGCCGCTGCCCGTCCCGCTGCCCGATCCCCTGATTGTCACTCTCCCCGTGCCTGTCTTCGTCTC
GTTCCCCGACTCGCCACCTCTCTCGTCCGTCCCGCTGCTGACCTGGTCCCTGCTAGCCGTTATATACATCAAAAA
CCGCGTCACTCGCTCTTGGTTCCCATCGGAGCACAGCGCCGAGAAACCGATATCCGAGGAAGAAAAGATTCGCAT
TCGCGACATTCTCGTCCCCATACTGGCATCGTCCGATGGCCCTGTTCAGCAGCAGCTCGTCCCCGTCCTTCAGCG
GATCCTCCAATGCGACTTTCCCGCTCGCTGGCCGCGCTTCATCGAGTTCACCATGGAGCTCATCAATACAAACAG
CCCGCGATCCGTCCACGCAGGCCTTCAATGCTTGCTCGCCCTCTGCCGCGCATTCCGCTACAAGTCGAGCGACGC
CCAAGATAGGCTGCAATTCGACTCCATCGTCGAGACGAGCTTCTCCCGTCTCGTCGTCATCTGCAACGAGCTGGT
GACACAGGAGAGTGACGAGGCTGGCGAGATGCTGCACCTCGCCCTCAAAGCTTTTAAACATGCGACATGGGTATT
GCCCGCCCCCTTACTCTTCTTCCCCACTTATGACCGATTGACACTGACATCCAACGTCACAAACCAGCTCGAGCT
GTCTCCCTACCTCCGGCAGCGTCAGGTCAACATTGCCTGGTGCACCGTCTTCCTCCAAACCGTCGCCAAGGCGAC
CCCTGCGAGCGCCTTGCAAGGCGATCAGTTCGACCGAGAGAAGCATCACTGGTGGAAAGCCAAGAAGTGGGCCTA
TTTTAACTTGAACCGCCTCTTTATCAGGTCCGTTTTCCCCGTCTCTGCATTTAGTTGCCTTCCGCGTTGACTGAC
CCCCGGCTATTGCAGGCACGGCAACCCGGCATCGCCCGGCAAGGGGGCCGAGGCCGCCCAGTTCGCCAACGATTT
CGCCACCACCATCGCGCCCGAGATCCTCAAGCACTATCTCCAAGAGATCGAGAAATGGGTGGCCAAGACGTCTTG
GCTCAGCCGGCCCTGCCTCTCCTATACGCTCGTCTTCCTCGACGAGTCTGTACGGCCCAAGGAGATGTGGACTCA
TCTCAAGCCGCATCTGACCAATCTCGTCACTCACTTTGTCTTTCCAGTGCTGTGCCTGACGTCAGACGACGTTGA
ACAGTTCGAGGAAGAGCCGGAGGAGTATCTACACCGCAAGCTCAACTACTTCGAGGAGGCCTCGGCCCCGGACGT
GGCCGCCACGAATTTCCTCGTCAACCTGACCAAGAACCGGCGCAAGGAGACGTTTGAGATTCTCAAGTTTGTCAA
TGCCGTCGTCAACGAGTACGAGCAGTCGGCCGACGACAAGAAGAACCACATCGCCAAGGAGGGCGCGCTGAGAAT
GATAGGCACACTCGCGCCCGTCATCCTCAGCAAGAAGAGCCCCATCGCCGACCAGGTCGAATACTTTCTGGTGCG
CTACGTCTTTCCCGATTTCACCAGCGGACAGGGTTACTTGCGAGCCAGAGCTTGCGACACGATCGAGAAGTTCGA
GCAGCTCAACTTCCAAGACCAGGGCAATCTTTTGACCATCTACCGGCACATCCTCGACTGCATGGCCGATCCGGC
GCTGCCTGTGCGCGTCACGGCCTCTCTGGCTCTACAGCCCTTGATCCGGCACGACCTGATACGCACGAGTATGCA
GCAGAGCATCCCGACCATCATGCAGCAGCTGCTCAAGCTGGCCAACGAGGTCGACATTGACGCGCTGGCCAACGT
CATGGAGGACTTTGTCGAGGTCTTCGCGGCGGAGCTCACGCCCTTTGCCGTCGCCCTCTGCGAGCAGCTTCGCGA
TACCTACCTCCGCATCGTGCGGGAGCTCCTCGAGAAGGAGAGCCGGGCGGGCGAGGACGGCGACGCCTACGTCGA
TTACGACGATAAGAGCATCACGGCGCTTGGCGTCTTGCAGACGATTGGGACCTTGATTCTCACGCTGGAGAGCAC
GCCCGATGTTTTACTCGTAATCGAGGCGGTGCTGATGCCCGTCATTAAGATTACGTTGGAGAACAAGCTATACGG
TCAGTCGCGCGCGCAGACATGTCGCCAACTTTGTGTTGCTGACGAGTTGTCTAGATCTATACAACGAGGTTTTCG
AAATCATCGACAGCTGCACCTTTGCCGCCAAGAGCATCTCGGCCAACATGTGGCAGGCCTTTGAGCTGATCCACA
CGACGTTCAAGGCCGGGGCGCAGTACTATCTCGAAGACATGCTGCCGGCGCTCGACAACTTTGTGCAATACGGCG
TTCCGCAGCTGGCGCAGAAGCCGCAATACGTGCAGGCGCTCTATTCGATGGTGGCCGACATGTTTTCCGACACGG
TTCAGGGGCCCGTGGAGCGCATCTGCGCATGCAAGCTGTCCGAGGCGATGATGCTGAGCCTCCGGGGCCACATTG
ACAGCTGCGTCGAGGGCTTTATCGTCATGACGATGAACATCCTGGCCGAAGAAGAGGTGGCGAACAGGAGCTACA
AGATCCACTTGATGGAGATGGTCATCAACTCCATCTACTACAACCCCCTGCTGGCGCTGCAGGTGCTGGAGAACA
AGGGCTGGACAAATAGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCTTTTAGTCGGGTCCACGACAAGAAGC
TGTGCATCGTGGCCATCTCGGCGCTCCTGAGTGTCAACCACGACCAGGTACCGGCCAGCGTCTCCGTCGGGTGGC
CGCGGCTGCTCCAGGGTATCACGGAGCTGTTCCGGACGTTGCCCATTGCCATGAAGAGTGCGTACTCTCCCCCCT
TTTTTGGAGACGCGGGCGAAGGCTGACTGTAATTCATAGATCGCGAAGAGGCTCTACGCGACGACTTCCACCTCG
AATCTACGTATGACTACGGCGACGAGGACGAGTGGGGCGACGAGGATGCCAACTGGAACGGCGAGGAGGAGCCCG
CGCAGGAGGAGGCGGCGGAGGCGAAGGATGAGAGCAAGGCCTATCTGGAGTTTCTCAACGACGAGGTGGGTGAAG
AGGCCGGAAGCGAGTTGAGGGCAGCCCCTGCTTACGATGACAACAGGCGCAAAAGTTTAGCCGCGGCGTCGAGAC
GGGCGACGACGACGACTTGGGCGAGGACAGTGTGCCGCTCGAGTCACCGCTGGACAGGGTGGAGCCCTATCAGTC
GTTCAAGTCGGTCATGATGAGTGAGTCTCGTGCTCCTCCGAGTTCAGGGAGAGGCTGACGATGTGTAGGGATGCA
ACAGGAGCAGCCGCAGTTCTACGCCAGCCTGGCGGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCAT
CATGAACAAGGCGGACGAAATCGCGGCCGCGAATGCGCAGCTGTTGGCGGCTCAGCAAGTCGCTCACAATGCCAA
CACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail