Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5135
Gene name
LocationContig_497:7104..8418
Strand-
Gene length (bp)1314
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 1.0E-30 16 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IR18|GRC3_GIBZE Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GRC3 PE=3 SV=2 4 434 5.0E-143
sp|A1CYR9|GRC3_NEOFI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=grc3 PE=3 SV=1 12 429 1.0E-80
sp|Q4WID9|GRC3_ASPFU Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=grc3 PE=3 SV=2 12 429 4.0E-80
sp|Q0CKU1|GRC3_ASPTN Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=grc3 PE=3 SV=1 12 429 2.0E-79
sp|A1CFB5|GRC3_ASPCL Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=grc3 PE=3 SV=1 2 429 1.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IR18|GRC3_GIBZE Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GRC3 PE=3 SV=2 4 434 5.0E-143
sp|A1CYR9|GRC3_NEOFI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=grc3 PE=3 SV=1 12 429 1.0E-80
sp|Q4WID9|GRC3_ASPFU Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=grc3 PE=3 SV=2 12 429 4.0E-80
sp|Q0CKU1|GRC3_ASPTN Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=grc3 PE=3 SV=1 12 429 2.0E-79
sp|A1CFB5|GRC3_ASPCL Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=grc3 PE=3 SV=1 2 429 1.0E-78
sp|Q2U0C4|GRC3_ASPOR Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=grc3 PE=3 SV=2 12 429 1.0E-78
sp|A2QNQ8|GRC3_ASPNC Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=grc3 PE=3 SV=2 12 429 2.0E-76
sp|Q5B4D1|GRC3_EMENI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grc3 PE=3 SV=1 12 432 2.0E-71
sp|Q9UU96|GRC3_SCHPO Polynucleotide 5'-hydroxyl-kinase grc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grc3 PE=1 SV=1 10 374 5.0E-35
sp|Q8VYP6|NOL9_ARATH Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Arabidopsis thaliana GN=At5g11010 PE=2 SV=1 4 368 2.0E-22
sp|P0CM78|GRC3_CRYNJ Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GRC3 PE=3 SV=1 13 418 1.0E-19
sp|P0CM79|GRC3_CRYNB Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GRC3 PE=3 SV=1 13 418 1.0E-19
sp|Q59U11|GRC3_CANAL Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRC3 PE=3 SV=1 12 433 8.0E-18
sp|Q6BQV7|GRC3_DEBHA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GRC3 PE=3 SV=2 11 433 1.0E-17
sp|Q3TZX8|NOL9_MOUSE Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Mus musculus GN=Nol9 PE=1 SV=1 1 159 2.0E-17
sp|Q6CQ06|GRC3_KLULA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRC3 PE=3 SV=1 1 433 2.0E-16
sp|Q07845|GRC3_YEAST Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRC3 PE=1 SV=1 12 433 5.0E-16
sp|Q54Z27|NOL9_DICDI Polynucleotide 5'-hydroxyl-kinase nol9 OS=Dictyostelium discoideum GN=nol9 PE=3 SV=1 11 154 1.0E-15
sp|E1BPN0|NOL9_BOVIN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Bos taurus GN=NOL9 PE=3 SV=1 10 159 4.0E-15
sp|Q6C5P9|GRC3_YARLI Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GRC3 PE=3 SV=1 11 203 1.0E-14
sp|Q5SY16|NOL9_HUMAN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1 10 176 2.0E-13
sp|Q6FW56|GRC3_CANGA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GRC3 PE=3 SV=1 1 156 5.0E-12
sp|A8WQV9|NOL9_CAEBR Polynucleotide 5'-hydroxyl-kinase nol-9 OS=Caenorhabditis briggsae GN=nol-9 PE=3 SV=2 9 384 4.0E-11
sp|Q753Y3|GRC3_ASHGO Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GRC3 PE=3 SV=1 6 203 6.0E-08
sp|Q54N48|CLP1_DICDI Protein CLP1 homolog OS=Dictyostelium discoideum GN=clp1 PE=3 SV=1 1 159 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2250
Ophiocordyceps australis map64 (Brazil) OphauB2|2853
Ophiocordyceps camponoti-floridani Ophcf2|05266
Ophiocordyceps camponoti-rufipedis Ophun1|5135 (this protein)
Ophiocordyceps kimflemingae Ophio5|1222
Ophiocordyceps subramaniannii Hirsu2|3322

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5135
MVESASQHQPSVLVCGPKSSGKSTFSRILTNRLLTTTHRQSGVAVLDLDPGQAEYGPPGTVSLVHVSQPNLGVPF
THPGVDDGAYKVVRCHSLASVNPASMTELHLECVVDLYDYYRHTLGRCPLVVNTPGWIFSLGLEFLLDVIVKVRP
VDVVYMSEDGPAETVEALGGATKSLTLLPSQPSEARTRTAAQMREMQTMSYFHLVPTHGSTRLGWSSQALSSVRP
VVVPYSGGRRGFRGILRYDYQLPVELTAEAIDGMVLAVVEVESLQAFRRHSLQASLGPSDGVGDGSDAALLFSPE
GIPVIPNADDVGLDPRHSRTVGMVLVRGVDTANRCLQVLTPMPLGRLQRARERGSGIVLVHGKMEAPTWAYTEHL
YEGTDEVKNGEGTDEEDSHDEGGTRGDESGVPWVEVFRGSQRRPVGSRVWRVRRDLGRGAGA*
Coding >Ophun1|5135
ATGGTAGAGTCGGCCTCCCAGCACCAGCCCTCGGTCCTCGTCTGCGGTCCCAAGTCATCGGGAAAGTCGACCTTT
TCACGCATCCTCACCAACCGGCTGCTGACGACGACGCACCGTCAGTCAGGCGTGGCGGTCCTCGATCTGGATCCC
GGACAGGCAGAGTACGGTCCGCCGGGGACGGTATCGCTGGTGCACGTCAGCCAGCCCAACCTCGGGGTCCCGTTT
ACGCATCCCGGTGTCGACGACGGGGCGTACAAGGTCGTGCGGTGCCATTCGCTGGCTTCGGTTAACCCGGCGTCG
ATGACGGAGTTGCATCTGGAGTGCGTCGTCGACTTGTACGATTACTACCGGCATACGCTCGGCAGGTGTCCGCTG
GTGGTGAACACGCCCGGTTGGATCTTTAGCTTGGGGTTGGAGTTTCTGCTGGATGTTATTGTCAAGGTGCGGCCC
GTCGACGTCGTCTACATGTCCGAGGACGGGCCAGCAGAGACGGTTGAGGCGCTGGGGGGCGCTACCAAGAGCCTT
ACTCTGCTGCCGTCGCAGCCGTCCGAGGCGAGGACACGGACGGCGGCACAGATGCGGGAGATGCAGACCATGTCG
TACTTTCACCTGGTGCCGACTCACGGCTCGACGAGGCTCGGCTGGTCGTCTCAGGCTCTCTCTTCCGTCCGACCG
GTTGTAGTGCCTTACTCGGGAGGGCGGCGCGGATTCCGAGGGATCCTGCGGTACGACTACCAGCTGCCGGTGGAG
CTCACGGCGGAAGCCATCGACGGCATGGTGTTGGCCGTGGTCGAGGTCGAGAGTCTGCAGGCTTTCCGTCGTCAT
TCGCTGCAGGCGAGTTTGGGGCCTAGCGATGGCGTGGGTGACGGGTCAGATGCTGCGCTTCTCTTTTCCCCGGAG
GGCATTCCGGTGATTCCCAACGCCGACGACGTCGGGCTCGACCCTCGGCACTCGCGCACCGTGGGCATGGTGCTG
GTCCGGGGTGTGGACACGGCGAATCGATGCCTTCAGGTGCTCACGCCGATGCCGCTCGGGAGGCTGCAACGGGCG
AGGGAACGGGGGAGTGGCATCGTCCTGGTGCACGGGAAGATGGAGGCGCCTACGTGGGCTTATACGGAGCACCTG
TACGAGGGGACGGACGAGGTGAAGAATGGTGAGGGGACGGACGAGGAGGATTCTCACGACGAGGGAGGGACTCGG
GGAGACGAGTCGGGTGTTCCGTGGGTCGAGGTGTTTAGGGGCAGCCAGAGGAGGCCGGTTGGGTCGAGGGTATGG
AGGGTACGACGGGATCTCGGGCGGGGAGCCGGGGCGTGA
Transcript >Ophun1|5135
ATGGTAGAGTCGGCCTCCCAGCACCAGCCCTCGGTCCTCGTCTGCGGTCCCAAGTCATCGGGAAAGTCGACCTTT
TCACGCATCCTCACCAACCGGCTGCTGACGACGACGCACCGTCAGTCAGGCGTGGCGGTCCTCGATCTGGATCCC
GGACAGGCAGAGTACGGTCCGCCGGGGACGGTATCGCTGGTGCACGTCAGCCAGCCCAACCTCGGGGTCCCGTTT
ACGCATCCCGGTGTCGACGACGGGGCGTACAAGGTCGTGCGGTGCCATTCGCTGGCTTCGGTTAACCCGGCGTCG
ATGACGGAGTTGCATCTGGAGTGCGTCGTCGACTTGTACGATTACTACCGGCATACGCTCGGCAGGTGTCCGCTG
GTGGTGAACACGCCCGGTTGGATCTTTAGCTTGGGGTTGGAGTTTCTGCTGGATGTTATTGTCAAGGTGCGGCCC
GTCGACGTCGTCTACATGTCCGAGGACGGGCCAGCAGAGACGGTTGAGGCGCTGGGGGGCGCTACCAAGAGCCTT
ACTCTGCTGCCGTCGCAGCCGTCCGAGGCGAGGACACGGACGGCGGCACAGATGCGGGAGATGCAGACCATGTCG
TACTTTCACCTGGTGCCGACTCACGGCTCGACGAGGCTCGGCTGGTCGTCTCAGGCTCTCTCTTCCGTCCGACCG
GTTGTAGTGCCTTACTCGGGAGGGCGGCGCGGATTCCGAGGGATCCTGCGGTACGACTACCAGCTGCCGGTGGAG
CTCACGGCGGAAGCCATCGACGGCATGGTGTTGGCCGTGGTCGAGGTCGAGAGTCTGCAGGCTTTCCGTCGTCAT
TCGCTGCAGGCGAGTTTGGGGCCTAGCGATGGCGTGGGTGACGGGTCAGATGCTGCGCTTCTCTTTTCCCCGGAG
GGCATTCCGGTGATTCCCAACGCCGACGACGTCGGGCTCGACCCTCGGCACTCGCGCACCGTGGGCATGGTGCTG
GTCCGGGGTGTGGACACGGCGAATCGATGCCTTCAGGTGCTCACGCCGATGCCGCTCGGGAGGCTGCAACGGGCG
AGGGAACGGGGGAGTGGCATCGTCCTGGTGCACGGGAAGATGGAGGCGCCTACGTGGGCTTATACGGAGCACCTG
TACGAGGGGACGGACGAGGTGAAGAATGGTGAGGGGACGGACGAGGAGGATTCTCACGACGAGGGAGGGACTCGG
GGAGACGAGTCGGGTGTTCCGTGGGTCGAGGTGTTTAGGGGCAGCCAGAGGAGGCCGGTTGGGTCGAGGGTATGG
AGGGTACGACGGGATCTCGGGCGGGGAGCCGGGGCGTGA
Gene >Ophun1|5135
ATGGTAGAGTCGGCCTCCCAGCACCAGCCCTCGGTCCTCGTCTGCGGTCCCAAGTCATCGGGAAAGTCGACCTTT
TCACGCATCCTCACCAACCGGCTGCTGACGACGACGCACCGTCAGTCAGGCGTGGCGGTCCTCGATCTGGATCCC
GGACAGGCAGAGTACGGTCCGCCGGGGACGGTATCGCTGGTGCACGTCAGCCAGCCCAACCTCGGGGTCCCGTTT
ACGCATCCCGGTGTCGACGACGGGGCGTACAAGGTCGTGCGGTGCCATTCGCTGGCTTCGGTTAACCCGGCGTCG
ATGACGGAGTTGCATCTGGAGTGCGTCGTCGACTTGTACGATTACTACCGGCATACGCTCGGCAGGTGTCCGCTG
GTGGTGAACACGCCCGGTTGGATCTTTAGCTTGGGGTTGGAGTTTCTGCTGGATGTTATTGTCAAGGTGCGGCCC
GTCGACGTCGTCTACATGTCCGAGGACGGGCCAGCAGAGACGGTTGAGGCGCTGGGGGGCGCTACCAAGAGCCTT
ACTCTGCTGCCGTCGCAGCCGTCCGAGGCGAGGACACGGACGGCGGCACAGATGCGGGAGATGCAGACCATGTCG
TACTTTCACCTGGTGCCGACTCACGGCTCGACGAGGCTCGGCTGGTCGTCTCAGGCTCTCTCTTCCGTCCGACCG
GTTGTAGTGCCTTACTCGGGAGGGCGGCGCGGATTCCGAGGGATCCTGCGGTACGACTACCAGCTGCCGGTGGAG
CTCACGGCGGAAGCCATCGACGGCATGGTGTTGGCCGTGGTCGAGGTCGAGAGTCTGCAGGCTTTCCGTCGTCAT
TCGCTGCAGGCGAGTTTGGGGCCTAGCGATGGCGTGGGTGACGGGTCAGATGCTGCGCTTCTCTTTTCCCCGGAG
GGCATTCCGGTGATTCCCAACGCCGACGACGTCGGGCTCGACCCTCGGCACTCGCGCACCGTGGGCATGGTGCTG
GTCCGGGGTGTGGACACGGCGAATCGATGCCTTCAGGTGCTCACGCCGATGCCGCTCGGGAGGCTGCAACGGGCG
AGGGAACGGGGGAGTGGCATCGTCCTGGTGCACGGGAAGATGGAGGCGCCTACGTGGGCTTATACGGAGCACCTG
TACGAGGGGACGGACGAGGTGAAGAATGGTGAGGGGACGGACGAGGAGGATTCTCACGACGAGGGAGGGACTCGG
GGAGACGAGTCGGGTGTTCCGTGGGTCGAGGTGTTTAGGGGCAGCCAGAGGAGGCCGGTTGGGTCGAGGGTATGG
AGGGTACGACGGGATCTCGGGCGGGGAGCCGGGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail