Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5128
Gene name
LocationContig_496:153..3418
Strand+
Gene length (bp)3265
Transcript length (bp)3012
Coding sequence length (bp)3012
Protein length (aa) 1004

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 9.3E-39 435 552
PF06395 CDC24 CDC24 Calponin 6.3E-31 116 204
PF00621 RhoGEF RhoGEF domain 9.0E-27 239 407
PF00564 PB1 PB1 domain 4.7E-08 913 981

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40995|SCD1_SCHPO Rho guanine nucleotide exchange factor scd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd1 PE=1 SV=2 87 554 2.0E-73
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 116 474 1.0E-43
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 239 480 4.0E-18
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 239 480 9.0E-18
sp|Q4VAC9|PKHG3_MOUSE Pleckstrin homology domain-containing family G member 3 OS=Mus musculus GN=Plekhg3 PE=1 SV=2 223 473 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40995|SCD1_SCHPO Rho guanine nucleotide exchange factor scd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd1 PE=1 SV=2 87 554 2.0E-73
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 116 474 1.0E-43
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 239 480 4.0E-18
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 239 480 9.0E-18
sp|Q4VAC9|PKHG3_MOUSE Pleckstrin homology domain-containing family G member 3 OS=Mus musculus GN=Plekhg3 PE=1 SV=2 223 473 5.0E-17
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 236 487 5.0E-17
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 236 488 1.0E-16
sp|A1L390|PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens GN=PLEKHG3 PE=1 SV=1 221 473 1.0E-16
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 232 472 1.0E-16
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 236 488 1.0E-16
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 236 488 1.0E-16
sp|Q13009|TIAM1_HUMAN T-lymphoma invasion and metastasis-inducing protein 1 OS=Homo sapiens GN=TIAM1 PE=1 SV=2 215 480 1.0E-16
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 216 472 2.0E-16
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 236 487 3.0E-16
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 224 560 3.0E-16
sp|Q60610|TIAM1_MOUSE T-lymphoma invasion and metastasis-inducing protein 1 OS=Mus musculus GN=Tiam1 PE=1 SV=1 220 480 3.0E-16
sp|P91621|SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster GN=sif PE=2 SV=2 239 408 4.0E-16
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 236 487 5.0E-16
sp|P91620|SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster GN=sif PE=2 SV=2 239 408 8.0E-16
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 225 477 1.0E-15
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 224 560 1.0E-14
sp|Q63406|MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus GN=Mcf2l PE=1 SV=3 215 473 1.0E-14
sp|O15068|MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens GN=MCF2L PE=1 SV=2 236 473 2.0E-14
sp|Q64096|MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus GN=Mcf2l PE=1 SV=2 215 473 8.0E-13
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 231 469 3.0E-12
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 231 469 7.0E-12
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 231 383 1.0E-11
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 236 383 3.0E-11
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 215 514 5.0E-11
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 234 442 7.0E-11
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 224 488 2.0E-10
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 236 469 2.0E-10
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 215 550 5.0E-10
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 214 559 6.0E-10
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 236 469 7.0E-10
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 236 469 7.0E-10
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 236 469 7.0E-10
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 215 479 1.0E-09
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 215 550 1.0E-09
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 213 471 2.0E-09
sp|Q6KAU7|PKHG2_MOUSE Pleckstrin homology domain-containing family G member 2 OS=Mus musculus GN=Plekhg2 PE=2 SV=2 234 511 3.0E-09
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 236 472 3.0E-09
sp|P15498|VAV_HUMAN Proto-oncogene vav OS=Homo sapiens GN=VAV1 PE=1 SV=4 213 472 9.0E-09
sp|Q45FX5|VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans GN=vav-1 PE=1 SV=1 236 475 1.0E-08
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 236 427 1.0E-08
sp|Q96PX9|PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens GN=PLEKHG4B PE=2 SV=4 238 469 1.0E-08
sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 236 472 1.0E-08
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 238 550 2.0E-08
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 215 479 2.0E-08
sp|Q08DN7|VAV_BOVIN Proto-oncogene vav OS=Bos taurus GN=VAV1 PE=2 SV=1 213 563 2.0E-08
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 236 427 4.0E-08
sp|Q8R0J1|PKHG6_MOUSE Pleckstrin homology domain-containing family G member 6 OS=Mus musculus GN=Plekhg6 PE=2 SV=2 232 472 7.0E-08
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 233 457 7.0E-08
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 236 427 9.0E-08
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 221 382 9.0E-08
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 232 480 9.0E-08
sp|Q54J11|GXCI_DICDI RhoGEF domain-containing protein gxcI OS=Dictyostelium discoideum GN=gxcI PE=3 SV=3 214 406 9.0E-08
sp|P10911|MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens GN=MCF2 PE=1 SV=3 236 451 1.0E-07
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 239 382 1.0E-07
sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 236 383 1.0E-07
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 225 469 1.0E-07
sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 236 383 1.0E-07
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 236 383 2.0E-07
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 233 383 2.0E-07
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 218 372 2.0E-07
sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=1 SV=1 236 383 2.0E-07
sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 236 383 2.0E-07
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 218 372 3.0E-07
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 358 485 4.0E-07
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 321 485 4.0E-07
sp|Q9UKW4|VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens GN=VAV3 PE=1 SV=1 236 472 5.0E-07
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 236 472 7.0E-07
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 235 407 8.0E-07
sp|Q9R0C8|VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus GN=Vav3 PE=1 SV=2 213 472 1.0E-06
sp|Q9NHV9|VAV_DROME Protein vav OS=Drosophila melanogaster GN=Vav PE=1 SV=2 227 472 3.0E-06
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 148 477 5.0E-06
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 236 472 5.0E-06
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 236 410 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030695 GTPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3677
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3533
Ophiocordyceps australis map64 (Brazil) OphauB2|1324
Ophiocordyceps camponoti-floridani Ophcf2|00466
Ophiocordyceps camponoti-rufipedis Ophun1|5128 (this protein)
Ophiocordyceps kimflemingae Ophio5|3586
Ophiocordyceps subramaniannii Hirsu2|7109

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5128
MAHAPLLRNNTVPVFESSFSSTGGLQQNSMSNAPRASQLSGTTAYAGSSSSSLNSLTSGGTVVPGQNGGPVVATT
NIINQKADASRSLYQICVSLKQRLAQVPGFQPFLEQLDPTDPVDPLWNLLRTGYPLLTIYNALQPPEPLKVDEAT
ASEAKKAKLAIFKFVQACLKDLGVRVSESFVITDLLGNDTSGFVKVTQVVNYVLDLAESRGLLLQSEPSQDDKAA
IAATGSQMSYRDHIVKELVDTERKYVQDLENLHDLKKALEQKGAVPGDIVHQIFLNINAILDFQRRFLIRVETTN
SMPKNVQRWGAPFCFYEDAFDIYQPFIANQRKAAQLANQVFDKIQLSDHPVAADFNTLDGFLLKPMQRLVKYPLL
LKDLHKKTEDPEIKEDLTLGCDAAERVLHKANEAVNRDLLDEALEDLINRVDDWKTHRVESFGKLLLHGVYSVIT
GKSDHEKDYEVYLFECILLCCKEASATRNRDKNKLRSSGPRIRNRSSKLQLKGRIFMTNVTDIVSLSKPGSHSVQ
IWWRGDPGVENFTIKFLNEENMKKWAAGLETQRKEMAPRLSSSVEGLAPDFSWTRDHAGGLENPYLNQDDDDDDE
SGLHTAPPPQFPMSTQPIARRPSNTNLRQRSATNDSSQSIASMARAPPSRFQVPAHPGSLSLQTHTNGTLSPGPR
INDSYFSPVAESPASSRASAASGMFPYFSKSSAPQPGWDDSNRYTAPAVPRAPSRDSSSPNPHNMSHRNPRGPSL
PVMATQGQSAAQQQRSRSYSTPDVNATGIPRQRQPSQGNVPAVPGIPQHLHPAHDANIPRSQTGSPRGETPLRTS
TQSPASQRERSHKHSNSLGGTMAQFPTQAAQARPNAASAGGGNYSLRVDSMSVNSRTVSPSQGAGSATPQSANDM
PMPTQLKVRVNCEGGTYVTLVVAFNITYQSLTDRIDAKLARVMNSSIGRGMLKLRYRDEDGDLVSIESDDDIQIA
FMEWREGMRNMYTSGVGEIELFCVGEAT*
Coding >Ophun1|5128
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGTCCCGGTCTTCGAGTCCAGCTTCAGCAGCACCGGCGGCCTG
CAACAGAACAGCATGAGCAATGCGCCGCGCGCCAGCCAGCTGTCGGGCACCACGGCATACGCGGGCTCGTCTTCT
TCCTCGCTCAACTCTCTGACGAGCGGCGGAACCGTCGTCCCCGGTCAGAACGGCGGTCCCGTCGTCGCCACGACA
AACATCATCAACCAAAAGGCCGACGCCTCGCGATCGCTCTACCAAATATGCGTCTCCCTGAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCCAGCCCTTTCTCGAGCAGCTCGATCCGACAGATCCCGTCGATCCGCTGTGGAACTTGCTT
CGCACCGGCTATCCCCTCTTGACCATATACAACGCTCTGCAGCCCCCCGAACCGCTCAAAGTCGATGAAGCCACC
GCTTCCGAGGCCAAAAAGGCCAAACTTGCCATCTTCAAGTTCGTCCAGGCTTGCTTAAAGGATCTCGGCGTTCGT
GTGTCTGAGAGCTTCGTCATCACCGATTTGCTGGGAAATGACACGAGCGGCTTTGTCAAAGTGACTCAAGTCGTC
AACTATGTTCTCGACCTCGCCGAGAGCCGCGGGCTTCTGCTGCAGAGCGAGCCGTCCCAAGACGACAAAGCCGCC
ATCGCCGCCACCGGCTCCCAGATGAGCTACAGAGACCACATCGTCAAGGAGCTGGTAGATACAGAACGCAAGTAT
GTGCAGGACCTGGAGAATCTCCACGACCTGAAGAAGGCCCTCGAGCAAAAGGGCGCGGTACCCGGCGATATTGTT
CACCAGATTTTTCTCAACATCAACGCTATCCTCGATTTCCAGCGTCGATTTCTCATCCGGGTCGAGACGACCAAC
TCGATGCCCAAAAACGTGCAGCGCTGGGGCGCGCCCTTTTGCTTCTACGAGGACGCGTTTGACATCTACCAGCCG
TTCATCGCCAACCAGAGAAAGGCTGCGCAGCTCGCTAACCAGGTCTTTGACAAGATCCAGTTGTCAGATCACCCA
GTGGCTGCCGACTTCAACACCCTCGATGGCTTTCTTCTCAAGCCCATGCAACGGCTGGTCAAGTACCCGCTGCTT
CTCAAGGATCTTCACAAAAAGACTGAAGATCCCGAGATCAAGGAAGACCTCACGCTGGGCTGCGACGCCGCCGAG
CGAGTGCTGCACAAGGCCAACGAAGCGGTGAACCGAGACCTCCTCGACGAAGCGCTCGAGGACCTCATCAACAGA
GTAGACGACTGGAAAACACATCGCGTGGAGTCGTTCGGAAAGCTGTTGCTACACGGCGTATACAGCGTCATTACG
GGCAAAAGCGATCACGAAAAAGACTACGAGGTCTATCTATTCGAGTGCATCCTGTTGTGTTGCAAAGAGGCCTCG
GCGACCAGAAATAGGGACAAGAATAAGCTGCGTTCTTCCGGACCTAGAATCCGCAACAGAAGCAGCAAGCTCCAG
CTCAAGGGAAGGATATTCATGACCAACGTAACTGACATCGTTTCTCTTTCCAAGCCCGGTTCGCATAGCGTCCAG
ATATGGTGGAGGGGCGATCCCGGCGTCGAGAACTTCACCATCAAGTTTCTGAACGAGGAGAACATGAAGAAGTGG
GCGGCTGGGCTCGAGACGCAGCGCAAGGAAATGGCCCCTCGCCTCTCGTCCAGCGTCGAGGGCCTGGCTCCGGAC
TTCTCCTGGACGAGAGATCACGCGGGCGGACTCGAGAACCCATACCTGAATCAAGACGATGACGACGACGACGAA
AGCGGCTTGCATACGGCGCCGCCACCACAGTTCCCCATGTCGACACAACCCATAGCCCGTCGACCCTCCAACACG
AACCTGAGGCAACGATCCGCGACAAACGACAGCTCCCAGTCCATCGCCAGCATGGCCAGGGCACCGCCTTCGCGC
TTCCAGGTCCCCGCCCATCCAGGGTCGCTGAGCCTCCAAACACACACCAACGGGACGCTGTCGCCAGGTCCCCGG
ATCAACGACAGCTACTTCTCCCCCGTGGCCGAGTCGCCGGCCTCGTCGCGAGCGAGCGCCGCCAGCGGCATGTTC
CCCTATTTCTCCAAGTCTTCGGCGCCGCAGCCGGGATGGGATGACAGCAACCGATACACGGCGCCGGCCGTACCG
CGCGCTCCGTCTCGGGACAGCTCATCGCCGAACCCGCACAACATGTCGCACCGAAACCCCCGTGGCCCTTCGCTA
CCGGTCATGGCCACACAGGGTCAGAGCGCCGCCCAACAACAGCGGAGCCGATCCTACAGCACCCCCGACGTCAAC
GCGACGGGCATCCCGCGGCAGCGCCAGCCGAGCCAGGGCAACGTCCCAGCCGTACCGGGCATCCCGCAGCATCTG
CATCCCGCGCACGACGCCAACATCCCGAGATCCCAGACCGGATCCCCCCGTGGCGAAACGCCGCTCCGGACGAGC
ACGCAGAGTCCCGCCAGCCAACGGGAACGGTCACACAAGCACTCCAACAGCCTGGGCGGCACTATGGCGCAATTC
CCCACGCAGGCGGCCCAGGCCCGACCGAACGCGGCTTCGGCCGGTGGCGGCAACTATTCGCTACGCGTCGACTCC
ATGTCGGTCAACTCGCGGACCGTCTCCCCGTCGCAAGGCGCCGGCTCAGCCACGCCTCAGTCGGCCAACGACATG
CCGATGCCGACACAACTCAAGGTCCGCGTCAACTGCGAAGGCGGCACCTACGTGACGCTCGTCGTCGCCTTCAAC
ATCACGTACCAGTCGTTGACGGATCGCATCGACGCCAAACTCGCGCGGGTCATGAACAGCAGCATCGGTAGGGGC
ATGCTTAAGCTGCGGTACCGCGACGAGGACGGCGATCTCGTCTCGATCGAGAGCGACGACGACATCCAGATCGCT
TTCATGGAGTGGCGGGAGGGCATGCGCAACATGTACACGTCCGGCGTGGGAGAGATAGAACTCTTTTGCGTGGGC
GAGGCGACTTGA
Transcript >Ophun1|5128
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGTCCCGGTCTTCGAGTCCAGCTTCAGCAGCACCGGCGGCCTG
CAACAGAACAGCATGAGCAATGCGCCGCGCGCCAGCCAGCTGTCGGGCACCACGGCATACGCGGGCTCGTCTTCT
TCCTCGCTCAACTCTCTGACGAGCGGCGGAACCGTCGTCCCCGGTCAGAACGGCGGTCCCGTCGTCGCCACGACA
AACATCATCAACCAAAAGGCCGACGCCTCGCGATCGCTCTACCAAATATGCGTCTCCCTGAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCCAGCCCTTTCTCGAGCAGCTCGATCCGACAGATCCCGTCGATCCGCTGTGGAACTTGCTT
CGCACCGGCTATCCCCTCTTGACCATATACAACGCTCTGCAGCCCCCCGAACCGCTCAAAGTCGATGAAGCCACC
GCTTCCGAGGCCAAAAAGGCCAAACTTGCCATCTTCAAGTTCGTCCAGGCTTGCTTAAAGGATCTCGGCGTTCGT
GTGTCTGAGAGCTTCGTCATCACCGATTTGCTGGGAAATGACACGAGCGGCTTTGTCAAAGTGACTCAAGTCGTC
AACTATGTTCTCGACCTCGCCGAGAGCCGCGGGCTTCTGCTGCAGAGCGAGCCGTCCCAAGACGACAAAGCCGCC
ATCGCCGCCACCGGCTCCCAGATGAGCTACAGAGACCACATCGTCAAGGAGCTGGTAGATACAGAACGCAAGTAT
GTGCAGGACCTGGAGAATCTCCACGACCTGAAGAAGGCCCTCGAGCAAAAGGGCGCGGTACCCGGCGATATTGTT
CACCAGATTTTTCTCAACATCAACGCTATCCTCGATTTCCAGCGTCGATTTCTCATCCGGGTCGAGACGACCAAC
TCGATGCCCAAAAACGTGCAGCGCTGGGGCGCGCCCTTTTGCTTCTACGAGGACGCGTTTGACATCTACCAGCCG
TTCATCGCCAACCAGAGAAAGGCTGCGCAGCTCGCTAACCAGGTCTTTGACAAGATCCAGTTGTCAGATCACCCA
GTGGCTGCCGACTTCAACACCCTCGATGGCTTTCTTCTCAAGCCCATGCAACGGCTGGTCAAGTACCCGCTGCTT
CTCAAGGATCTTCACAAAAAGACTGAAGATCCCGAGATCAAGGAAGACCTCACGCTGGGCTGCGACGCCGCCGAG
CGAGTGCTGCACAAGGCCAACGAAGCGGTGAACCGAGACCTCCTCGACGAAGCGCTCGAGGACCTCATCAACAGA
GTAGACGACTGGAAAACACATCGCGTGGAGTCGTTCGGAAAGCTGTTGCTACACGGCGTATACAGCGTCATTACG
GGCAAAAGCGATCACGAAAAAGACTACGAGGTCTATCTATTCGAGTGCATCCTGTTGTGTTGCAAAGAGGCCTCG
GCGACCAGAAATAGGGACAAGAATAAGCTGCGTTCTTCCGGACCTAGAATCCGCAACAGAAGCAGCAAGCTCCAG
CTCAAGGGAAGGATATTCATGACCAACGTAACTGACATCGTTTCTCTTTCCAAGCCCGGTTCGCATAGCGTCCAG
ATATGGTGGAGGGGCGATCCCGGCGTCGAGAACTTCACCATCAAGTTTCTGAACGAGGAGAACATGAAGAAGTGG
GCGGCTGGGCTCGAGACGCAGCGCAAGGAAATGGCCCCTCGCCTCTCGTCCAGCGTCGAGGGCCTGGCTCCGGAC
TTCTCCTGGACGAGAGATCACGCGGGCGGACTCGAGAACCCATACCTGAATCAAGACGATGACGACGACGACGAA
AGCGGCTTGCATACGGCGCCGCCACCACAGTTCCCCATGTCGACACAACCCATAGCCCGTCGACCCTCCAACACG
AACCTGAGGCAACGATCCGCGACAAACGACAGCTCCCAGTCCATCGCCAGCATGGCCAGGGCACCGCCTTCGCGC
TTCCAGGTCCCCGCCCATCCAGGGTCGCTGAGCCTCCAAACACACACCAACGGGACGCTGTCGCCAGGTCCCCGG
ATCAACGACAGCTACTTCTCCCCCGTGGCCGAGTCGCCGGCCTCGTCGCGAGCGAGCGCCGCCAGCGGCATGTTC
CCCTATTTCTCCAAGTCTTCGGCGCCGCAGCCGGGATGGGATGACAGCAACCGATACACGGCGCCGGCCGTACCG
CGCGCTCCGTCTCGGGACAGCTCATCGCCGAACCCGCACAACATGTCGCACCGAAACCCCCGTGGCCCTTCGCTA
CCGGTCATGGCCACACAGGGTCAGAGCGCCGCCCAACAACAGCGGAGCCGATCCTACAGCACCCCCGACGTCAAC
GCGACGGGCATCCCGCGGCAGCGCCAGCCGAGCCAGGGCAACGTCCCAGCCGTACCGGGCATCCCGCAGCATCTG
CATCCCGCGCACGACGCCAACATCCCGAGATCCCAGACCGGATCCCCCCGTGGCGAAACGCCGCTCCGGACGAGC
ACGCAGAGTCCCGCCAGCCAACGGGAACGGTCACACAAGCACTCCAACAGCCTGGGCGGCACTATGGCGCAATTC
CCCACGCAGGCGGCCCAGGCCCGACCGAACGCGGCTTCGGCCGGTGGCGGCAACTATTCGCTACGCGTCGACTCC
ATGTCGGTCAACTCGCGGACCGTCTCCCCGTCGCAAGGCGCCGGCTCAGCCACGCCTCAGTCGGCCAACGACATG
CCGATGCCGACACAACTCAAGGTCCGCGTCAACTGCGAAGGCGGCACCTACGTGACGCTCGTCGTCGCCTTCAAC
ATCACGTACCAGTCGTTGACGGATCGCATCGACGCCAAACTCGCGCGGGTCATGAACAGCAGCATCGGTAGGGGC
ATGCTTAAGCTGCGGTACCGCGACGAGGACGGCGATCTCGTCTCGATCGAGAGCGACGACGACATCCAGATCGCT
TTCATGGAGTGGCGGGAGGGCATGCGCAACATGTACACGTCCGGCGTGGGAGAGATAGAACTCTTTTGCGTGGGC
GAGGCGACTTGA
Gene >Ophun1|5128
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGTCCCGGTCTTCGAGTCCAGCTTCAGCAGCACCGGCGGCCTG
CAACAGAACAGCATGAGCAATGCGCCGCGCGCCAGCCAGCTGTCGGGCACCACGGCATACGCGGGCTCGTCTTCT
TCCTCGCTCAACTCTCTGACGAGCGGCGGAACCGTCGTCCCCGGTCAGAACGGCGGTCCCGTCGTCGCCACGACA
AACATCATCAACCAAAAGGCCGACGCCTCGCGATCGCTCTACCAAATATGCGTCTCCCTGAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCCAGCCCTTTCTCGAGCAGCTCGATCCGACAGATCCCGTCGATCCGCTGTGGAACTTGCTT
CGCACCGGCTATCCCCTCTTGACCATATACAACGCTCTGCAGCCCCCCGAACCGCTCAAAGTCGATGAAGCCACC
GCTTCCGAGGCCAAAAAGGCCAAACTTGCCATCTTCAAGTTCGTCCAGGCTTGCTTAAAGGATCTCGGCGTTCGT
GTGTCTGAGAGCTTCGTCATCACCGATTTGCTGGGAAATGACACGAGCGGCTTTGTCAAAGTAAGCCCCCCTCGT
CTTCGCCGCCCTCAGGATTGAGGCTATTTCCTGTATTGGATCCACTGACCCGACCGTCAAATAATAGGTGACTCA
AGTCGTCAACTATGTTCTCGACCTCGCCGAGAGCCGCGGGCTTCTGCTGCAGAGCGAGCCGTCCCAAGACGACAA
AGCCGCCATCGCCGCCACCGGCTCCCAGATGAGCTACAGAGACCACATCGTCAAGGAGCTGGTAGATACAGAACG
CAAGTATGTGCAGGACCTGGAGAATCTCCACGACCTGAAGAAGGCCCTCGAGCAAAAGGGCGCGGTACCCGGCGA
TATTGTTCACCAGATTTTTCTCAACATCAACGCTATCCTCGATTTCCAGCGTCGATTTCTCATCCGGGTCGAGAC
GACCAACTCGATGCCCAAAAACGTGCAGCGCTGGGGCGCGCCCTTTTGCTTCTACGAGGACGCGTTTGACATCTA
CCAGCCGTTCATCGCCAACCAGAGAAAGGCTGCGCAGCTCGCTAACCAGGTCTTTGACAAGATCCAGTTGTCAGA
TCACCCAGTGGCTGCCGACTTCAACACCCTCGATGGCTTTCTTCTCAAGCCCATGCAACGGCTGGTCAAGTACCC
GCTGCTTCTCAAGGTAAGCCTCGCGCCTCTCTGCACCGACTGTGGGGGGCGACATGCTGACCTCCGACCCAGGAT
CTTCACAAAAAGACTGAAGATCCCGAGATCAAGGAAGACCTCACGCTGGGCTGCGACGCCGCCGAGCGAGTGCTG
CACAAGGCCAACGAAGCGGTGAACCGAGACCTCCTCGACGAAGCGCTCGAGGACCTCATCAACAGAGTAGACGAC
TGGAAAACACATCGCGTGGAGTCGTTCGGAAAGCTGTTGCTACACGGCGTATACAGCGTCATTACGGGCAAAAGC
GATCACGAAAAAGACGTACGTTGGCAGTCGGCGTCATTTATTTTCTCCCAATATGCTGATGTGTGCATCCAGTAC
GAGGTCTATCTATTCGAGTGCATCCTGTTGTGTTGCAAAGAGGCCTCGGCGACCAGAAATAGGGACAAGAATAAG
CTGCGTTCTTCCGGACCTAGAATCCGCAACAGAAGCAGCAAGCTCCAGCTCAAGGGAAGGATATTCATGACCAAC
GTAACTGACATCGTTTCTCTTTCCAAGCCCGGTGAGTGCGGTCCCATGACATCGAGGCCCGAGCGTGTCTGACGA
TGGCTGCGCAGGTTCGCATAGCGTCCAGATATGGTGGAGGGGCGATCCCGGCGTCGAGAACTTCACCATCAAGTT
TCTGAACGAGGAGAACATGAAGAAGTGGGCGGCTGGGCTCGAGACGCAGCGCAAGGAAATGGCCCCTCGCCTCTC
GTCCAGCGTCGAGGGCCTGGCTCCGGACTTCTCCTGGACGAGAGATCACGCGGGCGGACTCGAGAACCCATACCT
GAATCAAGACGATGACGACGACGACGAAAGCGGCTTGCATACGGCGCCGCCACCACAGTTCCCCATGTCGACACA
ACCCATAGCCCGTCGACCCTCCAACACGAACCTGAGGCAACGATCCGCGACAAACGACAGCTCCCAGTCCATCGC
CAGCATGGCCAGGGCACCGCCTTCGCGCTTCCAGGTCCCCGCCCATCCAGGGTCGCTGAGCCTCCAAACACACAC
CAACGGGACGCTGTCGCCAGGTCCCCGGATCAACGACAGCTACTTCTCCCCCGTGGCCGAGTCGCCGGCCTCGTC
GCGAGCGAGCGCCGCCAGCGGCATGTTCCCCTATTTCTCCAAGTCTTCGGCGCCGCAGCCGGGATGGGATGACAG
CAACCGATACACGGCGCCGGCCGTACCGCGCGCTCCGTCTCGGGACAGCTCATCGCCGAACCCGCACAACATGTC
GCACCGAAACCCCCGTGGCCCTTCGCTACCGGTCATGGCCACACAGGGTCAGAGCGCCGCCCAACAACAGCGGAG
CCGATCCTACAGCACCCCCGACGTCAACGCGACGGGCATCCCGCGGCAGCGCCAGCCGAGCCAGGGCAACGTCCC
AGCCGTACCGGGCATCCCGCAGCATCTGCATCCCGCGCACGACGCCAACATCCCGAGATCCCAGACCGGATCCCC
CCGTGGCGAAACGCCGCTCCGGACGAGCACGCAGAGTCCCGCCAGCCAACGGGAACGGTCACACAAGCACTCCAA
CAGCCTGGGCGGCACTATGGCGCAATTCCCCACGCAGGCGGCCCAGGCCCGACCGAACGCGGCTTCGGCCGGTGG
CGGCAACTATTCGCTACGCGTCGACTCCATGTCGGTCAACTCGCGGACCGTCTCCCCGTCGCAAGGCGCCGGCTC
AGCCACGCCTCAGTCGGCCAACGACATGCCGATGCCGACACAACTCAAGGTCCGCGTCAACTGCGAAGGCGGCAC
CTACGTGACGCTCGTCGTCGCCTTCAACATCACGTACCAGTCGTTGACGGATCGCATCGACGCCAAACTCGCGCG
GGTCATGAACAGCAGCATCGGTAGGGGCATGCTTAAGCTGCGGTACCGCGACGAGGACGGCGATCTCGTCTCGAT
CGAGAGCGACGACGACATCCAGATCGCTTTCATGGAGTGGCGGGAGGGCATGCGCAACATGTACACGTCCGGCGT
GGGAGAGATAGAACTCTTTTGCGTGGGCGAGGCGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail