Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5127
Gene name
LocationContig_495:10475..12913
Strand+
Gene length (bp)2438
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05187 ETF_QO Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S 4.8E-48 567 670
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-09 133 191
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.1E-06 130 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 103 673 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 81 670 0.0E+00
sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 81 670 0.0E+00
sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 101 670 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 67 670 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 103 673 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 81 670 0.0E+00
sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 81 670 0.0E+00
sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 101 670 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 67 670 0.0E+00
sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 101 670 0.0E+00
sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 101 670 0.0E+00
sp|Q11190|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=3 SV=2 124 670 0.0E+00
sp|Q54XM6|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1 122 670 0.0E+00
sp|O22854|ETFQO_ARATH Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=ETFQO PE=2 SV=1 124 672 0.0E+00
sp|Q337B8|ETFQO_ORYSJ Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os10g0516300 PE=3 SV=1 86 670 0.0E+00
sp|Q08822|ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR2 PE=1 SV=1 124 673 0.0E+00
sp|Q9HZP5|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1 123 670 5.0E-173
sp|P94132|ETFD_ACIAD Probable electron transfer flavoprotein-ubiquinone oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=etfD PE=3 SV=1 121 670 5.0E-169
sp|P26484|FIXC_AZOC5 Protein FixC OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixC PE=3 SV=2 127 514 3.0E-26
sp|P77337|YDIS_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YdiS OS=Escherichia coli (strain K12) GN=ydiS PE=3 SV=1 127 516 2.0E-24
sp|Q53208|FIXC_RHISN Protein FixC OS=Rhizobium sp. (strain NGR234) GN=fixC PE=3 SV=1 127 515 1.0E-23
sp|Q8Z9K9|FIXC_SALTI Protein FixC OS=Salmonella typhi GN=fixC PE=3 SV=1 127 549 2.0E-23
sp|Q8ZRW9|FIXC_SALTY Protein FixC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fixC PE=3 SV=1 127 549 3.0E-23
sp|Q83SQ7|FIXC_SHIFL Protein FixC OS=Shigella flexneri GN=fixC PE=3 SV=1 127 450 6.0E-21
sp|P68644|FIXC_ECOLI Protein FixC OS=Escherichia coli (strain K12) GN=fixC PE=3 SV=1 127 450 1.0E-20
sp|P68645|FIXC_ECOL6 Protein FixC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fixC PE=3 SV=1 127 450 1.0E-20
sp|P10331|FIXC_BRADU Protein FixC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixC PE=3 SV=2 150 515 1.0E-20
sp|Q7AHT0|FIXC_ECO57 Protein FixC OS=Escherichia coli O157:H7 GN=fixC PE=3 SV=1 127 450 3.0E-20
sp|P09820|FIXC_RHIME Protein FixC OS=Rhizobium meliloti (strain 1021) GN=fixC PE=3 SV=1 127 515 3.0E-16
sp|P53572|FIXC_AZOVI Protein FixC OS=Azotobacter vinelandii GN=fixC PE=3 SV=1 157 514 4.0E-15
sp|Q46904|YGCN_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YgcN OS=Escherichia coli (strain K12) GN=ygcN PE=3 SV=2 150 516 6.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1685
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1450
Ophiocordyceps australis map64 (Brazil) OphauB2|3376
Ophiocordyceps camponoti-floridani Ophcf2|01211
Ophiocordyceps camponoti-rufipedis Ophun1|5127 (this protein)
Ophiocordyceps kimflemingae Ophio5|5598
Ophiocordyceps subramaniannii Hirsu2|1459

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5127
MLVRAESKYQDHNDLVCLKPPRVSRIGPPGVLSVFEARAGRDDDDDDDDDMAAPPAVVARCASRAAIASRCCLLP
SCRTPKTKTPLRSVLPAAAAAASRPTRWFSAGVPRRRPTDGQRGGTPERESDQVDVCIVGGGPAGLSAAIRLKQL
AAERDDFRVLVLEKAGDIGGHILSGAVLQPTSLRELLPNWIDDDNPSRFQHATPAGADHMRFLTRSAAIPLPAPP
QMSNHGNYIVSLNQFVKWLGEQAEEAGVEVYPGFAAAEVLYGPDGSVKGVATNDVGVARDGRRKDTFEPGMEFHA
RVTLFAEGCHGSLSKQVINKFDLRKDSQHQTYGLGLKELWEVDPAKFESGRVVHAMGYPLPRDVYGGSFMYHFGD
NLVSLGMVVSLDYRNPWMSPYQEFQKLKHHPLFSSLLEGGKCISYGARSLVEGGFQSIPKVAFPGGALIGDSAGF
VNVPKVKGTHNAIKSGMLAAEAAWTALSQSNDGTVFLYDYEDSLRQSSVWKELREVRNMRPSFHTPLGVYGGLAY
SGLEAFVFRGRAPWTLKHKEPDHAATQPADRYPKIEYEKPDGIISFDILTSVSRTGTNHEEDQPVHLQVADWDAH
TDKAYPAFKGLENRFCPAGVYEYVEDASKPHGVRFQINAQNCIHCKTCDIKAPQQDINWQVPQGGEGPKYYMT*
Coding >Ophun1|5127
ATGTTGGTGCGAGCCGAGAGCAAGTATCAAGACCACAACGACCTCGTGTGTCTCAAGCCCCCCCGTGTCTCCCGA
ATCGGCCCGCCGGGGGTGTTGAGCGTCTTCGAGGCACGGGCTGGGAGAGACGACGACGACGACGACGACGACGAC
ATGGCTGCCCCCCCAGCCGTCGTCGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCCTGCTCCCT
TCCTGCCGGACGCCGAAAACGAAGACGCCGCTGCGATCCGTCCTCCCCGCCGCCGCCGCCGCCGCCAGCCGGCCC
ACGCGATGGTTCAGTGCGGGCGTCCCTCGGCGACGGCCAACGGATGGTCAGAGGGGCGGAACCCCCGAGCGCGAA
TCGGATCAGGTGGACGTGTGTATCGTCGGCGGCGGACCCGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTG
GCGGCCGAACGCGATGACTTTCGCGTCTTGGTGCTGGAAAAGGCCGGTGACATCGGTGGCCATATCCTCTCCGGC
GCGGTGCTGCAGCCCACGTCGCTGAGGGAACTGCTCCCCAACTGGATCGACGATGATAACCCTTCGCGGTTCCAG
CATGCTACGCCAGCGGGAGCTGATCACATGCGCTTCCTCACCCGCTCGGCGGCCATCCCGCTGCCCGCGCCGCCG
CAGATGAGCAACCATGGAAACTACATCGTCAGTCTGAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAG
GCGGGCGTCGAGGTCTATCCCGGCTTCGCGGCCGCAGAAGTCCTCTACGGTCCGGACGGTTCCGTCAAGGGCGTC
GCCACCAACGACGTGGGAGTCGCTAGGGATGGGCGCCGCAAGGATACCTTTGAGCCGGGCATGGAGTTCCACGCG
CGTGTGACTCTCTTCGCTGAGGGTTGTCACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTGCGAAAG
GACAGCCAGCACCAGACGTACGGCCTCGGCCTCAAGGAGCTTTGGGAGGTCGATCCGGCCAAGTTCGAGAGCGGC
CGCGTCGTACACGCCATGGGCTACCCGCTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCACTTTGGCGAC
AACCTCGTCTCGCTGGGCATGGTCGTCTCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTTCAG
AAGCTCAAGCACCATCCACTCTTCAGCAGCCTTCTCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTG
GTCGAGGGCGGCTTTCAGTCCATCCCAAAGGTCGCCTTCCCCGGCGGTGCCCTCATCGGAGACTCTGCGGGTTTC
GTCAACGTCCCCAAGGTCAAGGGCACCCACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACG
GCCCTGAGCCAGAGCAACGACGGCACCGTATTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGG
AAGGAGCTCAGGGAGGTGCGCAACATGCGTCCCTCCTTTCACACGCCCCTGGGCGTCTACGGCGGCTTGGCCTAT
TCCGGCCTCGAGGCCTTTGTCTTCAGGGGCAGGGCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCC
ACTCAGCCGGCGGACCGGTATCCCAAGATCGAATACGAAAAGCCCGACGGTATAATCAGCTTCGACATACTGACA
AGCGTTTCCCGCACCGGAACCAACCACGAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCAC
ACCGACAAGGCCTATCCCGCCTTCAAGGGGCTAGAGAACCGCTTCTGCCCGGCCGGCGTGTACGAATACGTCGAG
GACGCGTCGAAGCCGCACGGGGTTAGGTTCCAAATCAACGCGCAAAACTGCATCCACTGCAAGACGTGCGATATC
AAGGCTCCCCAGCAAGATATCAACTGGCAGGTGCCTCAGGGAGGCGAAGGCCCCAAGTACTACATGACTTGA
Transcript >Ophun1|5127
ATGTTGGTGCGAGCCGAGAGCAAGTATCAAGACCACAACGACCTCGTGTGTCTCAAGCCCCCCCGTGTCTCCCGA
ATCGGCCCGCCGGGGGTGTTGAGCGTCTTCGAGGCACGGGCTGGGAGAGACGACGACGACGACGACGACGACGAC
ATGGCTGCCCCCCCAGCCGTCGTCGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCCTGCTCCCT
TCCTGCCGGACGCCGAAAACGAAGACGCCGCTGCGATCCGTCCTCCCCGCCGCCGCCGCCGCCGCCAGCCGGCCC
ACGCGATGGTTCAGTGCGGGCGTCCCTCGGCGACGGCCAACGGATGGTCAGAGGGGCGGAACCCCCGAGCGCGAA
TCGGATCAGGTGGACGTGTGTATCGTCGGCGGCGGACCCGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTG
GCGGCCGAACGCGATGACTTTCGCGTCTTGGTGCTGGAAAAGGCCGGTGACATCGGTGGCCATATCCTCTCCGGC
GCGGTGCTGCAGCCCACGTCGCTGAGGGAACTGCTCCCCAACTGGATCGACGATGATAACCCTTCGCGGTTCCAG
CATGCTACGCCAGCGGGAGCTGATCACATGCGCTTCCTCACCCGCTCGGCGGCCATCCCGCTGCCCGCGCCGCCG
CAGATGAGCAACCATGGAAACTACATCGTCAGTCTGAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAG
GCGGGCGTCGAGGTCTATCCCGGCTTCGCGGCCGCAGAAGTCCTCTACGGTCCGGACGGTTCCGTCAAGGGCGTC
GCCACCAACGACGTGGGAGTCGCTAGGGATGGGCGCCGCAAGGATACCTTTGAGCCGGGCATGGAGTTCCACGCG
CGTGTGACTCTCTTCGCTGAGGGTTGTCACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTGCGAAAG
GACAGCCAGCACCAGACGTACGGCCTCGGCCTCAAGGAGCTTTGGGAGGTCGATCCGGCCAAGTTCGAGAGCGGC
CGCGTCGTACACGCCATGGGCTACCCGCTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCACTTTGGCGAC
AACCTCGTCTCGCTGGGCATGGTCGTCTCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTTCAG
AAGCTCAAGCACCATCCACTCTTCAGCAGCCTTCTCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTG
GTCGAGGGCGGCTTTCAGTCCATCCCAAAGGTCGCCTTCCCCGGCGGTGCCCTCATCGGAGACTCTGCGGGTTTC
GTCAACGTCCCCAAGGTCAAGGGCACCCACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACG
GCCCTGAGCCAGAGCAACGACGGCACCGTATTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGG
AAGGAGCTCAGGGAGGTGCGCAACATGCGTCCCTCCTTTCACACGCCCCTGGGCGTCTACGGCGGCTTGGCCTAT
TCCGGCCTCGAGGCCTTTGTCTTCAGGGGCAGGGCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCC
ACTCAGCCGGCGGACCGGTATCCCAAGATCGAATACGAAAAGCCCGACGGTATAATCAGCTTCGACATACTGACA
AGCGTTTCCCGCACCGGAACCAACCACGAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCAC
ACCGACAAGGCCTATCCCGCCTTCAAGGGGCTAGAGAACCGCTTCTGCCCGGCCGGCGTGTACGAATACGTCGAG
GACGCGTCGAAGCCGCACGGGGTTAGGTTCCAAATCAACGCGCAAAACTGCATCCACTGCAAGACGTGCGATATC
AAGGCTCCCCAGCAAGATATCAACTGGCAGGTGCCTCAGGGAGGCGAAGGCCCCAAGTACTACATGACTTGA
Gene >Ophun1|5127
ATGTTGGTGCGAGCCGAGAGCAAGTATCAAGACCACAACGACCTCGTGTGTCTCAAGCCCCCCCGTGTCTCCCGA
ATCGGCCCGCCGGGGGTGTTGAGCGTCTTCGAGGCACGGGCTGGGTTAGCGTGACGGAGATAAGGGGGCGAACAG
GGAGGTGTTGATGGAGGATGAAGGATGAGCCGGATGCTGCATTGGTGGCGCGCATTCATTATGTGTGTCGTGCAT
CTGACATCACAGCTAACAGGGGTGGTAGAGGATGAAGAGGAGGTGTTCGTCCCGAACTGGAAGTCTTGTTGGTTC
GATTCATCGGCTCGCTATCGATAGAGCTGGTGATGACTCGACGAGGCACGTGCAGCGGCTTCCCTCGGGACTGTC
TGTTAGCGTCCCGGCCGTCCGGACGCCACCTGGAAGCGAGCCAATGGCCAGAGGGCCAATTGGGCTTGTCCTCGT
CACCAGCTAAAAACAACAAAGGAGAGACGACGACGACGACGACGACGACGACATGGCTGCCCCCCCAGCCGTCGT
CGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCCTGCTCCCTTCCTGCCGGACGCCGAAAACGAA
GACGCCGCTGCGATCCGTCCTCCCCGCCGCCGCCGCCGCCGCCAGCCGGCCCACGCGATGGTTCAGTGCGGGCGT
CCCTCGGCGACGGCCAACGGATGGTCAGAGGGGCGGAACCCCCGAGCGCGAATCGGATCAGGTGGACGTGTGTAT
CGTCGGCGGCGGACCCGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTGGCGGCCGAACGCGATGACTTTCG
CGTCTTGGTGCTGGAAAAGGCCGGTGACATCGGTGGCCATATCCTCTCCGGCGCGGTGCTGCAGCCCACGTCGCT
GAGGGAACTGCTCCCCAACTGGATCGACGATGATAACCCTTCGCGGTTCCAGCATGCTACGCCAGCGGGAGCTGA
TCACATGCGCTTCCTCACCCGCTCGGCGGCCATCCCGCTGCCCGCGCCGCCGCAGATGAGCAACCATGGAAACTA
CATCGTCAGTCTGAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAGGCGGGCGTCGAGGTCTATCCCGG
CTTCGCGGCCGCAGAAGTCCTCTACGGTCCGGACGGTTCCGTCAAGGGCGTCGCCACCAACGACGTGGGAGTCGC
TAGGGATGGGCGCCGCAAGGATACCTTTGAGCCGGGCATGGAGTTCCACGCGCGTGTGACTCTCTTCGCTGAGGG
TTGTCACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTGCGAAAGGACAGCCAGCACCAGACGTACGG
CCTCGGCCTCAAGGAGCTTTGGGAGGTCGATCCGGCCAAGTTCGAGAGCGGCCGCGTCGTACACGCCATGGGCTA
CCCGCTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCACTTTGGCGACAACCTCGTCTCGCTGGGCATGGT
CGTCTCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTTCAGAAGCTCAAGCACCATCCACTCTT
CAGCAGCCTTCTCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTGGTCGAGGGCGGCTTTCAGTCCAT
CCCAAAGGTCGCCTTCCCCGGCGGTGCCCTCATCGGAGACTCTGCGGGTTTCGTCAACGTCCCCAAGGTCAAGGG
CACCCACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACGGCCCTGAGCCAGAGCAACGACGG
CACCGTATTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGGAAGGAGCTCAGGGAGGTGCGCAA
CATGCGTCCCTCCTTTCACACGCCCCTGGGCGTCTACGGCGGCTTGGCCTATTCCGGCCTCGAGGCCTTTGTCTT
CAGGGGCAGGGCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCCACTCAGCCGGCGGACCGGTATCC
CAAGATCGAATACGAAAAGCCCGACGGTATAATCAGCTTCGACATACTGACAAGCGTTTCCCGCACCGGAACCAA
CCACGAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCACACCGACAAGGCCTATCCCGCCTT
CAAGGGGCTAGAGAACCGCTTCTGCCCGGCCGGCGTGTACGAATACGTCGAGGACGCGTCGAAGCCGCACGGGGT
TAGGTTCCAAATCAACGCGCAAAAGTGAGACACCTTTCCCTTTGCTGACCTTGGCTCCCTCCCAACGACGACGAG
CTGACGGGAGCAGCTGCATCCACTGCAAGACGTGCGATATCAAGGCTCCCCAGCAAGATATCAACTGGCAGGTGC
CTCAGGGAGGCGAAGGCCCCAAGTACTACATGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail