Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5125
Gene name
LocationContig_495:3098..5428
Strand-
Gene length (bp)2330
Transcript length (bp)2271
Coding sequence length (bp)2271
Protein length (aa) 757

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-17 63 132
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.8E-17 151 219
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-20 244 312
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.5E-06 347 379
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.3E-08 417 454
PF00658 PABP Poly-adenylate binding protein, unique domain 1.0E-26 667 731
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.5E-02 52 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 1 742 0.0E+00
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 1 739 0.0E+00
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 3 736 0.0E+00
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 1 740 0.0E+00
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 51 750 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 1 742 0.0E+00
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 1 739 0.0E+00
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 3 736 0.0E+00
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 1 740 0.0E+00
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 51 750 0.0E+00
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 46 740 0.0E+00
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 12 739 0.0E+00
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 46 730 0.0E+00
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 18 739 0.0E+00
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 18 739 0.0E+00
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 36 561 0.0E+00
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 27 530 0.0E+00
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 60 736 0.0E+00
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 60 736 0.0E+00
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 60 736 0.0E+00
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 45 740 0.0E+00
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 63 738 0.0E+00
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 59 734 0.0E+00
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 58 753 0.0E+00
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 59 738 0.0E+00
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 58 734 0.0E+00
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 58 740 0.0E+00
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 42 569 0.0E+00
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 59 555 0.0E+00
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 61 730 3.0E-178
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 61 730 3.0E-178
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 61 730 2.0E-177
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 61 730 2.0E-177
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 61 730 4.0E-177
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 60 545 4.0E-176
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 59 545 6.0E-174
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 61 730 4.0E-173
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 60 730 6.0E-168
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 61 730 8.0E-167
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 61 730 1.0E-164
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 61 741 1.0E-163
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 61 730 6.0E-163
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 61 575 2.0E-156
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 61 573 1.0E-153
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 61 754 4.0E-149
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 61 483 1.0E-148
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 56 730 1.0E-147
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 60 555 3.0E-147
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 60 539 1.0E-139
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 58 538 3.0E-138
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 1 471 8.0E-134
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 61 461 6.0E-132
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 65 460 4.0E-107
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 65 460 4.0E-107
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 65 460 4.0E-107
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 65 460 4.0E-107
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 65 460 4.0E-107
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 65 460 5.0E-107
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 62 558 6.0E-103
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 60 503 2.0E-98
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 56 505 7.0E-83
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 49 511 1.0E-72
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 61 233 5.0E-69
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 59 470 3.0E-52
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 62 335 4.0E-42
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 149 730 7.0E-39
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 145 481 4.0E-34
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 62 333 2.0E-33
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 145 496 4.0E-33
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 62 321 3.0E-32
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 62 321 3.0E-32
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 62 321 3.0E-32
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 62 321 3.0E-32
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 62 321 3.0E-32
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 62 321 4.0E-32
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 150 730 5.0E-31
sp|P39684|PES4_YEAST Protein PES4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PES4 PE=3 SV=2 63 451 6.0E-30
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 61 223 2.0E-28
sp|P38760|MIP6_YEAST RNA-binding protein MIP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP6 PE=1 SV=1 32 314 9.0E-28
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 153 462 1.0E-26
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 153 462 1.0E-26
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 153 462 1.0E-26
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 153 462 1.0E-26
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 153 462 1.0E-26
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 153 462 2.0E-26
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 61 231 3.0E-26
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 61 231 5.0E-26
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 61 231 5.0E-26
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 25 322 8.0E-26
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 45 326 3.0E-24
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 49 304 5.0E-24
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 48 307 6.0E-24
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 61 223 6.0E-24
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 62 310 2.0E-23
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 52 223 7.0E-23
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 62 304 9.0E-23
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 48 299 2.0E-22
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 61 322 2.0E-22
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 62 310 3.0E-22
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 48 307 2.0E-21
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 50 318 7.0E-21
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 61 322 7.0E-21
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 61 322 8.0E-21
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 62 310 2.0E-20
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 62 319 3.0E-20
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 59 234 4.0E-20
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 62 324 4.0E-20
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 61 322 8.0E-20
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 62 310 8.0E-20
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 131 317 1.0E-19
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 131 317 1.0E-19
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 131 317 1.0E-19
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 131 317 1.0E-19
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 150 462 2.0E-19
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 131 317 2.0E-19
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 62 326 2.0E-19
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 147 462 2.0E-19
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 147 462 3.0E-19
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 150 462 3.0E-19
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 150 462 3.0E-19
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 150 462 4.0E-19
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 62 304 4.0E-19
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 151 317 6.0E-19
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 150 462 9.0E-19
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 165 462 1.0E-18
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 62 322 1.0E-18
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 59 236 4.0E-18
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 63 221 4.0E-18
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 62 322 4.0E-18
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 62 326 5.0E-18
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 150 462 5.0E-18
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 137 513 6.0E-18
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 31 320 6.0E-18
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 658 730 1.0E-17
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 151 376 1.0E-17
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 150 382 1.0E-17
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 141 461 1.0E-17
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 61 320 1.0E-17
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 25 211 3.0E-17
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 25 211 3.0E-17
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 25 211 3.0E-17
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 244 467 3.0E-17
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 151 325 3.0E-17
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 151 325 4.0E-17
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 63 223 4.0E-17
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 62 315 5.0E-17
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 53 244 1.0E-16
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 61 322 1.0E-16
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 151 324 1.0E-16
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 141 457 2.0E-16
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 150 462 2.0E-16
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 244 462 2.0E-16
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 61 211 3.0E-16
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 25 211 3.0E-16
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 30 211 3.0E-16
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 63 210 3.0E-16
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 30 211 3.0E-16
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 150 303 3.0E-16
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 151 324 3.0E-16
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 150 462 3.0E-16
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 43 211 3.0E-16
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 150 303 3.0E-16
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 150 462 4.0E-16
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 61 227 4.0E-16
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 56 462 4.0E-16
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 56 462 5.0E-16
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 56 462 5.0E-16
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 61 304 5.0E-16
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 18 213 7.0E-16
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 662 756 8.0E-16
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 244 465 9.0E-16
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 33 231 1.0E-15
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 58 322 1.0E-15
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 58 322 1.0E-15
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 58 322 1.0E-15
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 144 303 1.0E-15
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 62 304 1.0E-15
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 150 316 1.0E-15
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 62 322 1.0E-15
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 665 730 2.0E-15
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 147 462 2.0E-15
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 37 211 2.0E-15
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 148 323 2.0E-15
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 145 303 2.0E-15
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 150 303 2.0E-15
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 63 225 3.0E-15
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 63 225 3.0E-15
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 62 462 3.0E-15
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 63 221 3.0E-15
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 60 213 3.0E-15
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 31 211 3.0E-15
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 31 211 3.0E-15
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 63 225 4.0E-15
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 63 225 4.0E-15
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 150 303 4.0E-15
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 59 213 5.0E-15
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 49 237 6.0E-15
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 151 376 6.0E-15
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 148 323 6.0E-15
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 63 225 7.0E-15
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 150 316 7.0E-15
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 59 259 8.0E-15
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 61 211 9.0E-15
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 141 339 1.0E-14
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 141 339 1.0E-14
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 56 462 1.0E-14
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 144 320 1.0E-14
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 151 317 1.0E-14
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 244 466 1.0E-14
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 151 323 1.0E-14
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 149 320 1.0E-14
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 61 257 1.0E-14
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 141 339 2.0E-14
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 141 339 2.0E-14
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 49 237 2.0E-14
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 59 213 2.0E-14
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 151 376 2.0E-14
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 59 213 2.0E-14
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 150 305 2.0E-14
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 61 214 2.0E-14
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 61 214 2.0E-14
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 61 257 2.0E-14
sp|Q94901|LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster GN=lark PE=1 SV=1 147 314 2.0E-14
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 59 214 2.0E-14
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 61 211 2.0E-14
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 63 222 3.0E-14
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 150 305 3.0E-14
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 3 304 3.0E-14
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 61 214 3.0E-14
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 147 462 4.0E-14
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 150 462 4.0E-14
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 244 467 5.0E-14
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 150 462 5.0E-14
sp|B3M3R5|SHEP_DROAN Protein alan shepard OS=Drosophila ananassae GN=shep PE=3 SV=2 143 309 5.0E-14
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 63 225 6.0E-14
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 143 309 6.0E-14
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 65 462 7.0E-14
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 143 309 8.0E-14
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 143 309 8.0E-14
sp|B4HUE4|SHEP_DROSE Protein alan shepard OS=Drosophila sechellia GN=shep PE=3 SV=1 143 309 9.0E-14
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 239 475 1.0E-13
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 149 326 1.0E-13
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 151 376 1.0E-13
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 150 382 1.0E-13
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 61 211 1.0E-13
sp|Q8MSV2|SHEP_DROME Protein alan shepard OS=Drosophila melanogaster GN=shep PE=1 SV=2 143 309 1.0E-13
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 138 352 1.0E-13
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 58 222 2.0E-13
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 58 222 2.0E-13
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 63 225 2.0E-13
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 151 325 2.0E-13
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 147 462 2.0E-13
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 59 218 2.0E-13
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 61 211 2.0E-13
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 148 320 3.0E-13
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 9 221 3.0E-13
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 16 335 3.0E-13
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 143 309 4.0E-13
sp|B4LFQ9|SHEP_DROVI Protein alan shepard OS=Drosophila virilis GN=shep PE=3 SV=2 143 309 4.0E-13
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 60 319 4.0E-13
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 243 479 5.0E-13
sp|B4IX08|SHEP_DROGR Protein alan shepard OS=Drosophila grimshawi GN=shep PE=3 SV=1 143 309 5.0E-13
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 151 323 6.0E-13
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 47 335 6.0E-13
sp|B4QRJ0|SHEP_DROSI Protein alan shepard OS=Drosophila simulans GN=shep PE=3 SV=1 143 309 7.0E-13
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 62 462 8.0E-13
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 243 479 9.0E-13
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 243 479 9.0E-13
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 47 335 9.0E-13
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 244 456 1.0E-12
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 142 376 1.0E-12
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 56 229 1.0E-12
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 150 376 2.0E-12
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 151 376 2.0E-12
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 150 305 2.0E-12
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 146 329 2.0E-12
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 146 320 2.0E-12
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 663 730 3.0E-12
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 143 305 3.0E-12
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 143 305 3.0E-12
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 150 305 3.0E-12
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 58 335 3.0E-12
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 58 318 3.0E-12
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 58 318 3.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 51 232 3.0E-12
sp|Q5ZK88|PSPC1_CHICK Paraspeckle component 1 OS=Gallus gallus GN=PSPC1 PE=2 SV=1 61 210 3.0E-12
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 150 376 4.0E-12
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 56 221 4.0E-12
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 245 461 4.0E-12
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 188 322 4.0E-12
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 188 322 4.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 51 232 4.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 51 232 4.0E-12
sp|Q4KLH4|PSPC1_RAT Paraspeckle component 1 OS=Rattus norvegicus GN=Pspc1 PE=1 SV=1 61 209 4.0E-12
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 58 335 4.0E-12
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 151 319 4.0E-12
sp|Q8R326|PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus GN=Pspc1 PE=1 SV=1 61 209 4.0E-12
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 663 740 5.0E-12
sp|Q1LZD9|PSPC1_BOVIN Paraspeckle component 1 OS=Bos taurus GN=PSPC1 PE=2 SV=1 61 209 5.0E-12
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 151 334 6.0E-12
sp|Q8WXF1|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens GN=PSPC1 PE=1 SV=1 61 209 7.0E-12
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 151 509 7.0E-12
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 151 503 8.0E-12
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 151 334 9.0E-12
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 57 326 1.0E-11
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 150 549 1.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 236 466 1.0E-11
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 55 221 1.0E-11
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 136 305 1.0E-11
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 136 305 1.0E-11
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 30 211 1.0E-11
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 30 211 1.0E-11
sp|Q9XSR3|RBM47_CANLF RNA-binding protein 47 OS=Canis lupus familiaris GN=RBM47 PE=2 SV=1 58 318 1.0E-11
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 150 562 2.0E-11
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 242 445 2.0E-11
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 242 445 2.0E-11
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 244 466 2.0E-11
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 242 469 2.0E-11
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 136 305 2.0E-11
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 136 305 2.0E-11
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 143 305 2.0E-11
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 150 305 2.0E-11
sp|Q6DGV1|CELF4_DANRE CUGBP Elav-like family member 4 OS=Danio rerio GN=celf4 PE=2 SV=1 151 334 2.0E-11
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 151 325 2.0E-11
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 243 537 3.0E-11
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 242 468 3.0E-11
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 242 468 3.0E-11
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 242 468 3.0E-11
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 61 206 3.0E-11
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 62 232 4.0E-11
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 150 314 4.0E-11
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 149 317 4.0E-11
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 130 310 4.0E-11
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 59 237 5.0E-11
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 150 379 6.0E-11
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 61 206 7.0E-11
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 242 380 7.0E-11
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 242 380 8.0E-11
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 62 219 9.0E-11
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 63 230 9.0E-11
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 55 229 9.0E-11
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 146 326 9.0E-11
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 149 325 1.0E-10
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 61 221 1.0E-10
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 149 320 1.0E-10
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 242 380 1.0E-10
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 242 380 1.0E-10
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 28 227 1.0E-10
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 150 320 1.0E-10
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 63 231 1.0E-10
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 151 322 1.0E-10
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 151 322 1.0E-10
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 151 322 1.0E-10
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 140 317 1.0E-10
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 149 308 1.0E-10
sp|Q4R535|CELF4_MACFA CUGBP Elav-like family member 4 OS=Macaca fascicularis GN=CELF4 PE=2 SV=1 151 334 1.0E-10
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 242 377 2.0E-10
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 242 380 2.0E-10
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 61 211 2.0E-10
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 151 322 2.0E-10
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 44 228 2.0E-10
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 50 218 2.0E-10
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 151 322 2.0E-10
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 151 322 2.0E-10
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 151 325 2.0E-10
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 151 322 2.0E-10
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 148 305 2.0E-10
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 44 228 2.0E-10
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 44 228 2.0E-10
sp|Q923K9|A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus GN=A1cf PE=1 SV=1 151 503 2.0E-10
sp|Q99181|HSH49_YEAST Protein HSH49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH49 PE=1 SV=1 62 223 2.0E-10
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 150 334 2.0E-10
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 242 377 3.0E-10
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 244 466 3.0E-10
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 239 468 3.0E-10
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 242 379 3.0E-10
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 242 377 3.0E-10
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 149 325 3.0E-10
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 150 334 3.0E-10
sp|Q1RMJ7|TSAP1_BOVIN tRNA selenocysteine 1-associated protein 1 OS=Bos taurus GN=TRNAU1AP PE=2 SV=1 60 235 3.0E-10
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 149 325 3.0E-10
sp|B3M3R5|SHEP_DROAN Protein alan shepard OS=Drosophila ananassae GN=shep PE=3 SV=2 59 211 4.0E-10
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 194 458 4.0E-10
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 237 325 4.0E-10
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 150 314 4.0E-10
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 149 325 4.0E-10
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 151 334 4.0E-10
sp|Q9NX07|TSAP1_HUMAN tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens GN=TRNAU1AP PE=1 SV=1 60 235 4.0E-10
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 151 334 4.0E-10
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 151 334 4.0E-10
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 148 320 4.0E-10
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 11 207 5.0E-10
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 237 325 5.0E-10
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 194 458 5.0E-10
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 244 466 6.0E-10
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 239 460 6.0E-10
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 47 318 6.0E-10
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 47 318 6.0E-10
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 58 322 6.0E-10
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 242 377 7.0E-10
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 62 319 7.0E-10
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 240 325 7.0E-10
sp|Q28HE9|CELF1_XENTR CUGBP Elav-like family member 1 OS=Xenopus tropicalis GN=celf1 PE=2 SV=1 151 303 7.0E-10
sp|Q6PF35|CEL1B_XENLA CUGBP Elav-like family member 1-B OS=Xenopus laevis GN=cugbp1-b PE=2 SV=1 151 303 7.0E-10
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 244 527 8.0E-10
sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 151 460 8.0E-10
sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus GN=Rbm4 PE=1 SV=1 151 314 8.0E-10
sp|Q96PK6|RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens GN=RBM14 PE=1 SV=2 151 320 8.0E-10
sp|Q5RC41|RBM14_PONAB RNA-binding protein 14 OS=Pongo abelii GN=RBM14 PE=2 SV=1 151 320 8.0E-10
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 240 325 8.0E-10
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 242 377 9.0E-10
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 242 377 9.0E-10
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 242 380 9.0E-10
sp|Q4R535|CELF4_MACFA CUGBP Elav-like family member 4 OS=Macaca fascicularis GN=CELF4 PE=2 SV=1 58 211 9.0E-10
sp|Q5EA36|RBM14_BOVIN RNA-binding protein 14 OS=Bos taurus GN=RBM14 PE=2 SV=1 151 320 9.0E-10
sp|Q8C2Q3|RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus GN=Rbm14 PE=1 SV=1 151 327 9.0E-10
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 240 325 9.0E-10
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 151 322 9.0E-10
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 151 322 9.0E-10
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 151 322 9.0E-10
sp|Q5R462|TSAP1_PONAB tRNA selenocysteine 1-associated protein 1 OS=Pongo abelii GN=TRNAU1AP PE=2 SV=1 60 235 9.0E-10
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 240 325 9.0E-10
sp|Q9QZI7|TSAP1_RAT tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus GN=Trnau1ap PE=1 SV=1 60 235 9.0E-10
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 242 377 1.0E-09
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 242 377 1.0E-09
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 238 460 1.0E-09
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 242 380 1.0E-09
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 242 380 1.0E-09
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 242 380 1.0E-09
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 215 380 1.0E-09
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 151 343 1.0E-09
sp|Q06AT9|RBM4B_PIG RNA-binding protein 4B OS=Sus scrofa GN=RBM4B PE=2 SV=1 151 314 1.0E-09
sp|Q3MHX3|RBM4_BOVIN RNA-binding protein 4 OS=Bos taurus GN=RBM4 PE=2 SV=1 151 314 1.0E-09
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 242 320 1.0E-09
sp|Q64LC9|RBM4B_RAT RNA-binding protein 4B OS=Rattus norvegicus GN=Rbm4b PE=1 SV=2 151 314 1.0E-09
sp|Q8VE92|RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus GN=Rbm4b PE=1 SV=1 151 314 1.0E-09
sp|Q4R979|RBM4_MACFA RNA-binding protein 4 OS=Macaca fascicularis GN=RBM4 PE=2 SV=1 151 314 1.0E-09
sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens GN=RBM4 PE=1 SV=1 151 314 1.0E-09
sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens GN=RBM4B PE=1 SV=1 151 314 1.0E-09
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 44 245 1.0E-09
sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 OS=Oryctolagus cuniculus GN=RBM4 PE=2 SV=1 151 314 1.0E-09
sp|Q5YD48|A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus GN=A1cf PE=1 SV=2 151 509 1.0E-09
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 663 730 2.0E-09
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 11 207 2.0E-09
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 182 456 2.0E-09
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 147 317 2.0E-09
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 237 463 2.0E-09
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 39 231 2.0E-09
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 150 334 2.0E-09
sp|Q80VC6|TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus GN=Trnau1ap PE=1 SV=2 60 235 2.0E-09
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 58 149 2.0E-09
sp|P23246|SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2 61 214 2.0E-09
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 62 232 2.0E-09
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 63 221 3.0E-09
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 151 463 3.0E-09
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 151 463 3.0E-09
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 151 325 3.0E-09
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 63 211 3.0E-09
sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=1 SV=1 151 460 3.0E-09
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 150 314 3.0E-09
sp|P53316|YG5B_YEAST Uncharacterized RNA-binding protein YGR250C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR250C PE=1 SV=1 146 317 3.0E-09
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 11 207 4.0E-09
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 149 314 4.0E-09
sp|Q4KM14|TSP1L_DANRE tRNA selenocysteine 1-associated protein 1-like OS=Danio rerio GN=trnau1apl PE=2 SV=1 61 234 4.0E-09
sp|Q8VIJ6|SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus GN=Sfpq PE=1 SV=1 61 214 4.0E-09
sp|Q1JPY8|PSPC1_DANRE Paraspeckle component 1 OS=Danio rerio GN=pspc1 PE=2 SV=1 61 214 4.0E-09
sp|Q9U1N0|HRP65_CHITE Hrp65 protein OS=Chironomus tentans GN=HRP65 PE=1 SV=1 63 209 4.0E-09
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 149 308 4.0E-09
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 63 230 5.0E-09
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 63 230 5.0E-09
sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 151 303 5.0E-09
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 150 314 5.0E-09
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 243 376 6.0E-09
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 34 229 6.0E-09
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 151 329 6.0E-09
sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 151 303 6.0E-09
sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 151 303 6.0E-09
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 151 317 6.0E-09
sp|Q5R5W2|TADBP_PONAB TAR DNA-binding protein 43 OS=Pongo abelii GN=TARDBP PE=2 SV=1 142 330 6.0E-09
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 235 377 7.0E-09
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 151 463 7.0E-09
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 151 463 7.0E-09
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 59 211 7.0E-09
sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 151 460 7.0E-09
sp|Q8N6W0|CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1 150 329 7.0E-09
sp|Q13148|TADBP_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens GN=TARDBP PE=1 SV=1 142 330 7.0E-09
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 239 460 8.0E-09
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 150 326 8.0E-09
sp|Q7TN33|CELF6_MOUSE CUGBP Elav-like family member 6 OS=Mus musculus GN=Celf6 PE=2 SV=1 151 334 8.0E-09
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 32 237 9.0E-09
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 63 211 9.0E-09
sp|Q9P6M8|PABPX_SCHPO mRNA export factor crp79 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crp79 PE=2 SV=2 149 240 9.0E-09
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 63 211 9.0E-09
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 63 211 9.0E-09
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 150 458 1.0E-08
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 140 314 1.0E-08
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 150 320 1.0E-08
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 150 320 1.0E-08
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 150 317 1.0E-08
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 149 300 1.0E-08
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 149 317 1.0E-08
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 60 211 1.0E-08
sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 151 460 1.0E-08
sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 151 303 1.0E-08
sp|Q96J87|CELF6_HUMAN CUGBP Elav-like family member 6 OS=Homo sapiens GN=CELF6 PE=1 SV=1 151 334 1.0E-08
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 50 222 1.0E-08
sp|Q9IBD0|CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio GN=celf1 PE=1 SV=1 151 303 1.0E-08
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 63 211 1.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 602 738 2.0E-08
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 150 379 2.0E-08
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 182 456 2.0E-08
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 182 456 2.0E-08
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 182 456 2.0E-08
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 182 456 2.0E-08
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 59 231 2.0E-08
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 150 320 2.0E-08
sp|Q1LZD9|PSPC1_BOVIN Paraspeckle component 1 OS=Bos taurus GN=PSPC1 PE=2 SV=1 242 377 2.0E-08
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 151 325 2.0E-08
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 151 325 2.0E-08
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 63 211 2.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 148 322 2.0E-08
sp|Q28F51|TADBP_XENTR TAR DNA-binding protein 43 OS=Xenopus tropicalis GN=tardbp PE=2 SV=1 146 329 2.0E-08
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 148 300 2.0E-08
sp|Q8JGR6|NCBP2_DANRE Nuclear cap-binding protein subunit 2 OS=Danio rerio GN=ncbp2 PE=2 SV=2 58 149 2.0E-08
sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 50 210 2.0E-08
sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 151 303 2.0E-08
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 58 149 2.0E-08
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 58 149 2.0E-08
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 58 291 3.0E-08
sp|Q9XSR3|RBM47_CANLF RNA-binding protein 47 OS=Canis lupus familiaris GN=RBM47 PE=2 SV=1 151 463 3.0E-08
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 151 325 3.0E-08
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 151 325 3.0E-08
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 151 325 3.0E-08
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 58 149 3.0E-08
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 58 149 3.0E-08
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 58 149 3.0E-08
sp|Q503H1|TSAP1_DANRE tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1 62 211 3.0E-08
sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 47 305 3.0E-08
sp|A5E1Z4|EIF3G_LODEL Eukaryotic translation initiation factor 3 subunit G OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF35 PE=3 SV=1 220 320 3.0E-08
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 225 319 3.0E-08
sp|A4RHN3|EIF3G_MAGO7 Eukaryotic translation initiation factor 3 subunit G OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF35 PE=3 SV=1 240 319 3.0E-08
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 140 299 3.0E-08
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 43 212 3.0E-08
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 182 456 4.0E-08
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 60 214 4.0E-08
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 57 213 4.0E-08
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 137 320 4.0E-08
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 245 318 4.0E-08
sp|Q921F2|TADBP_MOUSE TAR DNA-binding protein 43 OS=Mus musculus GN=Tardbp PE=1 SV=1 142 330 4.0E-08
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 151 334 4.0E-08
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 148 459 5.0E-08
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 148 459 5.0E-08
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 151 322 5.0E-08
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 137 320 5.0E-08
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 131 345 5.0E-08
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 243 456 6.0E-08
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 151 312 6.0E-08
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 59 211 6.0E-08
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 58 149 6.0E-08
sp|Q6P0B1|CELF2_DANRE CUGBP Elav-like family member 2 OS=Danio rerio GN=celf2 PE=2 SV=1 151 303 6.0E-08
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 253 320 6.0E-08
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 244 466 7.0E-08
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 151 305 7.0E-08
sp|Q923K9|A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus GN=A1cf PE=1 SV=1 47 318 7.0E-08
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 61 134 7.0E-08
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 151 299 7.0E-08
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 58 149 7.0E-08
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 60 149 7.0E-08
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 60 149 8.0E-08
sp|Q5ZK88|PSPC1_CHICK Paraspeckle component 1 OS=Gallus gallus GN=PSPC1 PE=2 SV=1 244 377 9.0E-08
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 245 318 9.0E-08
sp|Q9UT83|MUG28_SCHPO Meiotically up-regulated gene 28 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug28 PE=1 SV=1 150 245 9.0E-08
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 151 320 9.0E-08
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 60 141 1.0E-07
sp|Q4KLH4|PSPC1_RAT Paraspeckle component 1 OS=Rattus norvegicus GN=Pspc1 PE=1 SV=1 242 377 1.0E-07
sp|Q8R326|PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus GN=Pspc1 PE=1 SV=1 242 377 1.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 139 258 1.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 136 258 1.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 136 258 1.0E-07
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 57 218 1.0E-07
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 57 218 1.0E-07
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 57 218 1.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 136 258 1.0E-07
sp|Q5YD48|A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus GN=A1cf PE=1 SV=2 47 318 1.0E-07
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 57 206 1.0E-07
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 42 214 1.0E-07
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 150 317 1.0E-07
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 148 300 1.0E-07
sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrnpdl-b PE=2 SV=1 151 300 1.0E-07
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 17 243 1.0E-07
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 59 379 1.0E-07
sp|Q7ZXE2|CELF2_XENLA CUGBP Elav-like family member 2 OS=Xenopus laevis GN=celf2 PE=1 SV=1 151 303 1.0E-07
sp|Q5ZLN5|TADBP_CHICK TAR DNA-binding protein 43 OS=Gallus gallus GN=TARDBP PE=2 SV=1 142 329 1.0E-07
sp|A4IIM2|CELF2_XENTR CUGBP Elav-like family member 2 OS=Xenopus tropicalis GN=celf2 PE=2 SV=1 151 303 1.0E-07
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 58 149 1.0E-07
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 149 300 1.0E-07
sp|Q99K48|NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus GN=Nono PE=1 SV=3 61 206 1.0E-07
sp|Q5FVM4|NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus GN=Nono PE=1 SV=3 61 206 1.0E-07
sp|Q8WXF1|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens GN=PSPC1 PE=1 SV=1 242 377 2.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 151 325 2.0E-07
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 152 221 2.0E-07
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 134 299 2.0E-07
sp|B0W939|NCBP2_CULQU Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 58 149 2.0E-07
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 42 149 2.0E-07
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 242 325 2.0E-07
sp|A7EWN6|EIF3G_SCLS1 Eukaryotic translation initiation factor 3 subunit G OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif35 PE=3 SV=1 233 319 2.0E-07
sp|A6SGN8|EIF3G_BOTFB Eukaryotic translation initiation factor 3 subunit G OS=Botryotinia fuckeliana (strain B05.10) GN=tif35 PE=3 SV=1 233 319 2.0E-07
sp|Q5RFL9|NONO_PONAB Non-POU domain-containing octamer-binding protein OS=Pongo abelii GN=NONO PE=2 SV=3 61 206 2.0E-07
sp|Q15233|NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens GN=NONO PE=1 SV=4 61 206 2.0E-07
sp|Q0P4R6|RBM46_XENTR Probable RNA-binding protein 46 OS=Xenopus tropicalis GN=rbm46 PE=2 SV=1 169 460 2.0E-07
sp|Q7T2T1|CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus GN=CELF2 PE=1 SV=2 138 303 2.0E-07
sp|C8V330|EIF3G_EMENI Eukaryotic translation initiation factor 3 subunit G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif35 PE=3 SV=1 238 319 2.0E-07
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 240 319 2.0E-07
sp|Q5R995|CELF1_PONAB CUGBP Elav-like family member 1 OS=Pongo abelii GN=CELF1 PE=2 SV=1 151 303 2.0E-07
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 245 318 2.0E-07
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 60 149 2.0E-07
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 7 227 3.0E-07
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 59 211 3.0E-07
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 139 239 3.0E-07
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 58 228 3.0E-07
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 57 218 3.0E-07
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 58 228 3.0E-07
sp|Q6IQ97|RBM41_DANRE RNA-binding protein 4.1 OS=Danio rerio GN=rbm4.1 PE=1 SV=1 151 320 3.0E-07
sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 151 303 3.0E-07
sp|Q9Z0H4|CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus GN=Celf2 PE=1 SV=1 151 303 3.0E-07
sp|Q5R8Y8|CELF2_PONAB CUGBP Elav-like family member 2 OS=Pongo abelii GN=CELF2 PE=2 SV=2 151 303 3.0E-07
sp|O95319|CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens GN=CELF2 PE=1 SV=1 151 303 3.0E-07
sp|Q8GZ26|BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana GN=BRN2 PE=2 SV=1 149 221 3.0E-07
sp|Q0CPF9|EIF3G_ASPTN Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif35 PE=3 SV=1 238 319 3.0E-07
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 151 479 4.0E-07
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 59 211 4.0E-07
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 150 320 4.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 150 459 4.0E-07
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 59 211 4.0E-07
sp|Q04047|NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster GN=nonA PE=1 SV=2 63 221 4.0E-07
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 151 232 4.0E-07
sp|Q9XFD1|NCBP2_ARATH Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 60 134 4.0E-07
sp|Q84L14|NCBP2_ORYSJ Nuclear cap-binding protein subunit 2 OS=Oryza sativa subsp. japonica GN=CBP20 PE=2 SV=1 58 134 4.0E-07
sp|Q80YT9|RBM11_MOUSE Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 243 382 4.0E-07
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 60 214 5.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 139 239 5.0E-07
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 62 214 5.0E-07
sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 51 210 5.0E-07
sp|Q6IQ97|RBM41_DANRE RNA-binding protein 4.1 OS=Danio rerio GN=rbm4.1 PE=1 SV=1 63 221 5.0E-07
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 242 320 5.0E-07
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 244 323 5.0E-07
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 242 331 5.0E-07
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 151 343 5.0E-07
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 244 322 5.0E-07
sp|Q9C8M0|CID8_ARATH Polyadenylate-binding protein-interacting protein 8 OS=Arabidopsis thaliana GN=CID8 PE=1 SV=1 131 300 5.0E-07
sp|Q2U002|EIF3G_ASPOR Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif35 PE=3 SV=1 233 319 5.0E-07
sp|P78795|EIF3G_SCHPO Eukaryotic translation initiation factor 3 subunit G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif35 PE=1 SV=2 214 304 5.0E-07
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 187 376 6.0E-07
sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 58 149 6.0E-07
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 58 149 6.0E-07
sp|Q4X1I3|EIF3G_ASPFU Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif35 PE=3 SV=1 238 319 6.0E-07
sp|B0XS28|EIF3G_ASPFC Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tif35 PE=3 SV=1 238 319 6.0E-07
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 151 298 6.0E-07
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 52 206 7.0E-07
sp|Q8N6W0|CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1 45 211 7.0E-07
sp|A1DGS2|EIF3G_NEOFI Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=TIF35 PE=3 SV=1 238 319 7.0E-07
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 63 232 7.0E-07
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 58 149 7.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 63 134 7.0E-07
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 44 137 8.0E-07
sp|A4IIM2|CELF2_XENTR CUGBP Elav-like family member 2 OS=Xenopus tropicalis GN=celf2 PE=2 SV=1 27 210 8.0E-07
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 243 323 8.0E-07
sp|A3GGU2|EIF3G_PICST Eukaryotic translation initiation factor 3 subunit G OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF35 PE=3 SV=2 235 320 8.0E-07
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 58 149 8.0E-07
sp|A1C646|EIF3G_ASPCL Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif35 PE=3 SV=1 238 319 8.0E-07
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 242 376 9.0E-07
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 60 227 9.0E-07
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 57 218 9.0E-07
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 57 218 9.0E-07
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 57 218 9.0E-07
sp|Q6MFP4|EIF3G_NEUCR Eukaryotic translation initiation factor 3 subunit G OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3g PE=3 SV=2 240 319 9.0E-07
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 151 299 9.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 148 223 9.0E-07
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 151 479 1.0E-06
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 151 479 1.0E-06
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 57 218 1.0E-06
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 57 211 1.0E-06
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 57 206 1.0E-06
sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus GN=Rbm4 PE=1 SV=1 244 382 1.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 63 211 1.0E-06
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 151 320 1.0E-06
sp|A2R7Z2|EIF3G_ASPNC Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif35 PE=3 SV=1 238 319 1.0E-06
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 151 298 1.0E-06
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 151 299 1.0E-06
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 245 318 1.0E-06
sp|Q8CFD1|RBM45_RAT RNA-binding protein 45 OS=Rattus norvegicus GN=Rbm45 PE=1 SV=1 73 210 1.0E-06
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 243 344 2.0E-06
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 176 326 2.0E-06
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 242 483 2.0E-06
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 59 211 2.0E-06
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 59 211 2.0E-06
sp|Q06AT9|RBM4B_PIG RNA-binding protein 4B OS=Sus scrofa GN=RBM4B PE=2 SV=1 241 382 2.0E-06
sp|Q64LC9|RBM4B_RAT RNA-binding protein 4B OS=Rattus norvegicus GN=Rbm4b PE=1 SV=2 244 382 2.0E-06
sp|Q8VE92|RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus GN=Rbm4b PE=1 SV=1 244 382 2.0E-06
sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens GN=RBM4B PE=1 SV=1 244 382 2.0E-06
sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 OS=Oryctolagus cuniculus GN=RBM4 PE=2 SV=1 244 382 2.0E-06
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 54 218 2.0E-06
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 56 237 2.0E-06
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 60 149 2.0E-06
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 148 223 2.0E-06
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 60 149 2.0E-06
sp|Q9GRX4|NONA_DROLR Protein no-on-transient A OS=Drosophila littoralis GN=nonA PE=2 SV=1 63 221 2.0E-06
sp|Q8BHN5|RBM45_MOUSE RNA-binding protein 45 OS=Mus musculus GN=Rbm45 PE=1 SV=1 57 210 2.0E-06
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 58 149 2.0E-06
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 416 470 2.0E-06
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 58 185 2.0E-06
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 58 185 2.0E-06
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 416 470 2.0E-06
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 52 207 3.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 244 325 3.0E-06
sp|Q9IBD0|CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio GN=celf1 PE=1 SV=1 51 210 3.0E-06
sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 51 210 3.0E-06
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 57 197 3.0E-06
sp|Q7ZXE2|CELF2_XENLA CUGBP Elav-like family member 2 OS=Xenopus laevis GN=celf2 PE=1 SV=1 35 210 3.0E-06
sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 40 210 3.0E-06
sp|Q9Z0H4|CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus GN=Celf2 PE=1 SV=1 40 210 3.0E-06
sp|Q5R8Y8|CELF2_PONAB CUGBP Elav-like family member 2 OS=Pongo abelii GN=CELF2 PE=2 SV=2 40 210 3.0E-06
sp|O95319|CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens GN=CELF2 PE=1 SV=1 40 210 3.0E-06
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 244 525 3.0E-06
sp|B3P0D7|NCBP2_DROER Nuclear cap-binding protein subunit 2 OS=Drosophila erecta GN=Cbp20 PE=3 SV=1 58 149 3.0E-06
sp|B4QV17|NCBP2_DROSI Nuclear cap-binding protein subunit 2 OS=Drosophila simulans GN=Cbp20 PE=3 SV=1 58 149 3.0E-06
sp|B4IBA4|NCBP2_DROSE Nuclear cap-binding protein subunit 2 OS=Drosophila sechellia GN=Cbp20 PE=3 SV=1 58 149 3.0E-06
sp|Q9V3L6|NCBP2_DROME Nuclear cap-binding protein subunit 2 OS=Drosophila melanogaster GN=Cbp20 PE=1 SV=1 58 149 3.0E-06
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 151 312 3.0E-06
sp|Q59ZV5|EIF3G_CANAL Eukaryotic translation initiation factor 3 subunit G OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF35 PE=3 SV=1 236 320 3.0E-06
sp|Q9GRW7|NONA_DROVI Protein no-on-transient A OS=Drosophila virilis GN=nonA PE=2 SV=1 63 221 3.0E-06
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 58 134 3.0E-06
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 151 221 3.0E-06
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 244 318 3.0E-06
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 63 134 3.0E-06
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 58 222 3.0E-06
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 176 326 4.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 60 214 4.0E-06
sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 51 207 4.0E-06
sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 51 210 4.0E-06
sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 51 207 4.0E-06
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 152 223 4.0E-06
sp|Q8GZ26|BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana GN=BRN2 PE=2 SV=1 63 233 4.0E-06
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 141 315 4.0E-06
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 148 223 4.0E-06
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 63 143 4.0E-06
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 63 134 4.0E-06
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 63 134 4.0E-06
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 63 143 4.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 52 151 4.0E-06
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 148 223 4.0E-06
sp|B4PL68|NCBP2_DROYA Nuclear cap-binding protein subunit 2 OS=Drosophila yakuba GN=Cbp20 PE=3 SV=1 58 149 4.0E-06
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 243 321 4.0E-06
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 244 318 4.0E-06
sp|Q3B7L6|SRSF6_BOVIN Serine/arginine-rich splicing factor 6 OS=Bos taurus GN=SRSF6 PE=2 SV=1 151 312 4.0E-06
sp|Q3MHX3|RBM4_BOVIN RNA-binding protein 4 OS=Bos taurus GN=RBM4 PE=2 SV=1 244 382 5.0E-06
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 244 376 5.0E-06
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 63 134 5.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 63 134 5.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 63 134 5.0E-06
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 242 334 5.0E-06
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 245 318 5.0E-06
sp|Q8L3X8|SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana GN=SCL30 PE=1 SV=1 246 328 5.0E-06
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 58 150 5.0E-06
sp|Q8WP23|BOLL_MACFA Protein boule-like OS=Macaca fascicularis GN=BOLL PE=2 SV=2 151 228 5.0E-06
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 243 319 5.0E-06
sp|Q8N9W6|BOLL_HUMAN Protein boule-like OS=Homo sapiens GN=BOLL PE=1 SV=2 151 228 5.0E-06
sp|Q4R979|RBM4_MACFA RNA-binding protein 4 OS=Macaca fascicularis GN=RBM4 PE=2 SV=1 244 382 6.0E-06
sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens GN=RBM4 PE=1 SV=1 244 382 6.0E-06
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 47 218 6.0E-06
sp|Q7T2T1|CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus GN=CELF2 PE=1 SV=2 40 210 6.0E-06
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 152 221 6.0E-06
sp|Q924M5|BOLL_MOUSE Protein boule-like OS=Mus musculus GN=Boll PE=1 SV=2 151 228 6.0E-06
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 262 318 6.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 243 323 6.0E-06
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 416 470 6.0E-06
sp|Q6PF35|CEL1B_XENLA CUGBP Elav-like family member 1-B OS=Xenopus laevis GN=cugbp1-b PE=2 SV=1 51 210 7.0E-06
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 58 222 7.0E-06
sp|B4M205|NCB2A_DROVI Nuclear cap-binding protein subunit 2-A OS=Drosophila virilis GN=Cbp20-A PE=3 SV=1 58 149 7.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 243 323 7.0E-06
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 245 318 7.0E-06
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 243 323 7.0E-06
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 243 388 8.0E-06
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 46 219 8.0E-06
sp|Q1HE01|NCBP2_BOMMO Nuclear cap-binding protein subunit 2 OS=Bombyx mori PE=2 SV=1 60 149 8.0E-06
sp|Q1PDV2|SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana GN=SCL28 PE=1 SV=1 228 330 8.0E-06
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 133 321 9.0E-06
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 46 219 9.0E-06
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 242 319 1.0E-05
sp|G3V6S8|SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus GN=Srsf6 PE=1 SV=1 151 312 1.0E-05
sp|Q3TWW8|SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus GN=Srsf6 PE=1 SV=1 151 312 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1687
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2143
Ophiocordyceps australis map64 (Brazil) OphauB2|3379
Ophiocordyceps camponoti-floridani Ophcf2|01213
Ophiocordyceps camponoti-rufipedis Ophun1|5125 (this protein)
Ophiocordyceps kimflemingae Ophio5|7486
Ophiocordyceps subramaniannii Hirsu2|1463

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5125
MAAPTAPSAVDQLASDLASASINGNNDARVPVIDTNVAAGAVDDASGPTPNSAVPHPQNSASLYVGELDFSVTEA
MLFELFSQIGAVASIRVCRDAVTRRSLGYAYVNYNSTADGEKALEELNYTLIKGRPCRIMWSQRDPALRKTGQGN
VFIKNLDVAIDNKALHDTFAAFGNILSCKVAQDENGNSKGYGFVHYETDEAAQQAIKHVNGMLLNEKKVYVGHHI
PKKDRQSKFEEMKANFTNVYVKNIAPEASDDEFRDLFERHGEITSSSLARDQDGKSRGFGFVNFTTHEAAAKAVD
ELNGKDFHGQDLYVSRAQKKHEREEELRRSYEAARLEKASKYQGVNLYIKNLDDEVDDEKLRLMFSEFGPITSAK
VMRESMFEGGEDKDIKDKENKKDDGRDSDEDDQSDRKSDKRDRRLGKSKGFGFVCFSSPDDATKAVAEMNQRMVN
GKPLYVALAQRKDVRKSQLEASIQARNQLRMQQAVAAAGMTQQYIQPPVFYAPGQQAGFLPQAGRGMAFPQPAMG
MGGVQGGRPGQFPGYPQQGGRGGVPQQMPPSMYGMPGQYPPQYGQPGTPQFLAAMQQAQQAAALAGGRGGPQAGR
GGIPGVPPAAPAGMPGAGMPGFPPNNRQQGGMGRGAGANGGGRNGGFPNQGGRGGDMNATAMLQSQIAGAQPAQQ
KQLLGEMIFPKIQAINSELAGKITGMLLEMENSELINLIEDESALKAKVDEALTVYDEYIKGQGGPGPEGHEGKK
DEAPKM*
Coding >Ophun1|5125
ATGGCCGCTCCCACTGCCCCCAGTGCTGTTGACCAGCTTGCTAGCGACCTCGCCAGCGCCTCTATCAATGGCAAC
AATGATGCCAGGGTTCCTGTCATCGACACCAATGTCGCCGCGGGTGCCGTCGACGATGCCTCGGGCCCGACGCCC
AACTCGGCCGTCCCGCACCCCCAGAACTCGGCCTCCCTCTATGTCGGCGAGCTCGACTTCTCCGTCACTGAGGCT
ATGCTCTTTGAGCTTTTCTCCCAGATCGGTGCCGTCGCCTCCATCCGCGTCTGTCGCGACGCTGTTACCCGTCGC
TCTCTGGGCTACGCCTACGTCAACTACAACTCGACTGCCGATGGTGAAAAGGCCCTCGAGGAGCTCAACTACACC
CTAATCAAGGGCCGTCCCTGTCGCATCATGTGGTCTCAGCGCGACCCGGCTCTTCGCAAGACGGGCCAGGGCAAC
GTTTTCATCAAAAACCTCGATGTCGCCATCGACAACAAGGCCCTCCACGACACCTTTGCTGCCTTTGGCAACATT
CTCAGCTGCAAGGTTGCCCAGGATGAGAACGGCAACTCCAAGGGATATGGCTTCGTCCACTACGAGACTGATGAG
GCTGCGCAACAGGCTATCAAGCACGTTAATGGCATGCTTCTCAACGAGAAGAAAGTCTATGTCGGCCACCACATT
CCCAAGAAGGATCGCCAGAGCAAGTTTGAGGAGATGAAGGCCAACTTCACAAACGTCTACGTCAAGAACATCGCC
CCCGAGGCCAGCGATGACGAGTTCCGCGATCTCTTTGAGAGGCACGGCGAAATCACGTCGTCTTCCCTCGCCCGC
GACCAGGATGGCAAGAGCCGTGGCTTTGGCTTTGTCAACTTCACCACTCACGAGGCTGCTGCCAAGGCTGTTGAC
GAGCTCAACGGCAAGGATTTCCATGGCCAGGATCTCTACGTCAGCCGCGCCCAGAAGAAGCATGAACGTGAAGAG
GAACTTCGCAGGTCCTACGAGGCGGCCCGTCTCGAAAAGGCCAGCAAGTATCAGGGTGTCAACCTTTACATCAAG
AACCTGGACGACGAGGTGGACGACGAAAAGCTCCGCCTGATGTTTTCCGAATTTGGCCCCATAACTTCGGCCAAG
GTCATGCGCGAGTCGATGTTTGAAGGCGGAGAGGACAAGGACATCAAGGACAAAGAGAACAAGAAGGACGACGGC
AGGGACAGCGATGAAGATGACCAGTCCGACAGGAAGTCGGATAAGCGAGACAGAAGGCTCGGCAAGAGCAAGGGC
TTCGGTTTCGTTTGCTTCAGCAGCCCCGATGATGCCACCAAGGCCGTGGCCGAGATGAACCAGCGCATGGTCAAC
GGCAAGCCCCTCTACGTCGCCCTGGCTCAGCGCAAGGACGTTCGCAAGAGCCAGCTGGAGGCCAGCATCCAGGCT
CGCAACCAGTTGCGCATGCAGCAGGCGGTGGCTGCTGCTGGTATGACACAGCAGTACATTCAGCCTCCCGTCTTC
TACGCCCCAGGCCAGCAGGCCGGATTCCTGCCTCAGGCCGGCCGTGGCATGGCCTTTCCCCAGCCGGCCATGGGC
ATGGGCGGCGTCCAGGGCGGTCGCCCGGGACAGTTCCCCGGATATCCCCAGCAAGGGGGTCGCGGCGGCGTCCCT
CAGCAGATGCCTCCCAGCATGTACGGCATGCCGGGCCAGTATCCGCCTCAGTACGGCCAGCCCGGAACGCCCCAG
TTCCTGGCGGCCATGCAGCAGGCCCAGCAAGCTGCAGCCCTCGCTGGCGGACGTGGAGGTCCTCAGGCCGGCCGG
GGCGGCATCCCCGGCGTACCCCCTGCGGCGCCGGCCGGCATGCCCGGCGCTGGCATGCCCGGCTTCCCTCCTAAC
AACCGGCAGCAGGGCGGCATGGGCCGCGGCGCCGGCGCCAATGGCGGTGGACGCAACGGCGGCTTCCCTAACCAA
GGTGGCCGTGGAGGCGACATGAACGCGACGGCCATGCTGCAGTCCCAGATCGCTGGAGCGCAGCCGGCTCAGCAG
AAGCAGCTCCTCGGCGAGATGATTTTCCCCAAGATCCAGGCCATTAACTCGGAGTTGGCGGGCAAGATCACGGGC
ATGCTCCTCGAAATGGAGAACTCGGAGCTCATCAATCTTATCGAGGATGAGTCTGCGCTCAAGGCCAAGGTGGAC
GAGGCTCTCACCGTCTACGACGAGTACATCAAGGGCCAGGGCGGTCCCGGGCCCGAGGGCCACGAGGGCAAGAAG
GACGAGGCTCCCAAGATGTAG
Transcript >Ophun1|5125
ATGGCCGCTCCCACTGCCCCCAGTGCTGTTGACCAGCTTGCTAGCGACCTCGCCAGCGCCTCTATCAATGGCAAC
AATGATGCCAGGGTTCCTGTCATCGACACCAATGTCGCCGCGGGTGCCGTCGACGATGCCTCGGGCCCGACGCCC
AACTCGGCCGTCCCGCACCCCCAGAACTCGGCCTCCCTCTATGTCGGCGAGCTCGACTTCTCCGTCACTGAGGCT
ATGCTCTTTGAGCTTTTCTCCCAGATCGGTGCCGTCGCCTCCATCCGCGTCTGTCGCGACGCTGTTACCCGTCGC
TCTCTGGGCTACGCCTACGTCAACTACAACTCGACTGCCGATGGTGAAAAGGCCCTCGAGGAGCTCAACTACACC
CTAATCAAGGGCCGTCCCTGTCGCATCATGTGGTCTCAGCGCGACCCGGCTCTTCGCAAGACGGGCCAGGGCAAC
GTTTTCATCAAAAACCTCGATGTCGCCATCGACAACAAGGCCCTCCACGACACCTTTGCTGCCTTTGGCAACATT
CTCAGCTGCAAGGTTGCCCAGGATGAGAACGGCAACTCCAAGGGATATGGCTTCGTCCACTACGAGACTGATGAG
GCTGCGCAACAGGCTATCAAGCACGTTAATGGCATGCTTCTCAACGAGAAGAAAGTCTATGTCGGCCACCACATT
CCCAAGAAGGATCGCCAGAGCAAGTTTGAGGAGATGAAGGCCAACTTCACAAACGTCTACGTCAAGAACATCGCC
CCCGAGGCCAGCGATGACGAGTTCCGCGATCTCTTTGAGAGGCACGGCGAAATCACGTCGTCTTCCCTCGCCCGC
GACCAGGATGGCAAGAGCCGTGGCTTTGGCTTTGTCAACTTCACCACTCACGAGGCTGCTGCCAAGGCTGTTGAC
GAGCTCAACGGCAAGGATTTCCATGGCCAGGATCTCTACGTCAGCCGCGCCCAGAAGAAGCATGAACGTGAAGAG
GAACTTCGCAGGTCCTACGAGGCGGCCCGTCTCGAAAAGGCCAGCAAGTATCAGGGTGTCAACCTTTACATCAAG
AACCTGGACGACGAGGTGGACGACGAAAAGCTCCGCCTGATGTTTTCCGAATTTGGCCCCATAACTTCGGCCAAG
GTCATGCGCGAGTCGATGTTTGAAGGCGGAGAGGACAAGGACATCAAGGACAAAGAGAACAAGAAGGACGACGGC
AGGGACAGCGATGAAGATGACCAGTCCGACAGGAAGTCGGATAAGCGAGACAGAAGGCTCGGCAAGAGCAAGGGC
TTCGGTTTCGTTTGCTTCAGCAGCCCCGATGATGCCACCAAGGCCGTGGCCGAGATGAACCAGCGCATGGTCAAC
GGCAAGCCCCTCTACGTCGCCCTGGCTCAGCGCAAGGACGTTCGCAAGAGCCAGCTGGAGGCCAGCATCCAGGCT
CGCAACCAGTTGCGCATGCAGCAGGCGGTGGCTGCTGCTGGTATGACACAGCAGTACATTCAGCCTCCCGTCTTC
TACGCCCCAGGCCAGCAGGCCGGATTCCTGCCTCAGGCCGGCCGTGGCATGGCCTTTCCCCAGCCGGCCATGGGC
ATGGGCGGCGTCCAGGGCGGTCGCCCGGGACAGTTCCCCGGATATCCCCAGCAAGGGGGTCGCGGCGGCGTCCCT
CAGCAGATGCCTCCCAGCATGTACGGCATGCCGGGCCAGTATCCGCCTCAGTACGGCCAGCCCGGAACGCCCCAG
TTCCTGGCGGCCATGCAGCAGGCCCAGCAAGCTGCAGCCCTCGCTGGCGGACGTGGAGGTCCTCAGGCCGGCCGG
GGCGGCATCCCCGGCGTACCCCCTGCGGCGCCGGCCGGCATGCCCGGCGCTGGCATGCCCGGCTTCCCTCCTAAC
AACCGGCAGCAGGGCGGCATGGGCCGCGGCGCCGGCGCCAATGGCGGTGGACGCAACGGCGGCTTCCCTAACCAA
GGTGGCCGTGGAGGCGACATGAACGCGACGGCCATGCTGCAGTCCCAGATCGCTGGAGCGCAGCCGGCTCAGCAG
AAGCAGCTCCTCGGCGAGATGATTTTCCCCAAGATCCAGGCCATTAACTCGGAGTTGGCGGGCAAGATCACGGGC
ATGCTCCTCGAAATGGAGAACTCGGAGCTCATCAATCTTATCGAGGATGAGTCTGCGCTCAAGGCCAAGGTGGAC
GAGGCTCTCACCGTCTACGACGAGTACATCAAGGGCCAGGGCGGTCCCGGGCCCGAGGGCCACGAGGGCAAGAAG
GACGAGGCTCCCAAGATGTAG
Gene >Ophun1|5125
ATGGCCGCTCCCACTGCCCCCAGTGCTGTTGACCAGCTTGCTAGCGACCTCGCCAGCGCCTCTATCAATGGCAAC
AATGATGCCAGGGTTCCTGTCATCGACACCAATGTCGCCGCGGGTGCCGTCGACGATGCCTCGGGCCCGACGCCC
AACTCGGCCGTCCCGCACCCCCAGAACTCGGCCTCCCTCTATGTCGGCGAGCTCGACTTCTCCGTCACTGAGGCT
ATGCTCTTTGAGCTTTTCTCCCAGATCGGTGCCGTCGCCTCCATCCGCGTCTGTCGCGACGCTGTTACCCGTCGC
TCTCTGGGCTACGCCTACGTCAACTACAACTCGACTGCCGATGGTGAAAAGGCCCTCGAGGAGCTCAACTACACC
CTAATCAAGGGCCGTCCCTGTCGCATCATGTGGTCTCAGCGCGACCCGGCTCTTCGCAAGACGGGCCAGGGCAAC
GTTTTCATCAAAAACCTCGATGTCGCCATCGACAACAAGGCCCTCCACGACACCTTTGCTGCCTTTGGCAACATT
CTCAGCTGCAAGGTTGCCCAGGATGAGAACGGCAACTCCAAGGGATATGGCTTCGTCCACTACGAGACTGATGAG
GCTGCGCAACAGGCTATCAAGCACGTTAATGGCATGCTTCTCAACGAGAAGAAAGTCTATGTCGGCCACCACATT
CCCAAGAAGGATCGCCAGAGCAAGTTTGAGGAGATGAAGGCCAACTTCACAAACGTCTACGTCAAGAACATCGCC
CCCGAGGCCAGCGATGACGAGTTCCGCGATCTCTTTGAGAGGCACGGCGAAATCACGTCGTCTTCCCTCGCCCGC
GACCAGGATGGCAAGAGCCGTGGCTTTGGCTTTGTCAACTTCACCACTCACGAGGCTGCTGCCAAGGCTGTTGAC
GAGCTCAACGGCAAGGATTTCCATGGCCAGGATCTCTACGTCAGCCGCGCCCAGAAGAAGCATGAACGTGAAGAG
GAACTTCGCAGGTCCTACGAGGCGGCCCGTCTCGAAAAGGCCAGCAAGTATCAGGGTGTCAACCTTTACATCAAG
AACCTGGACGACGAGGTGGACGACGAAAAGCTCCGCCTGATGTTTTCCGAATTTGGCCCCATAACTTCGGCCAAG
GTCATGCGCGAGTCGATGTTTGAAGGCGGAGAGGACAAGGACATCAAGGACAAAGAGAACAAGAAGGACGACGGC
AGGGACAGCGATGAAGATGACCAGTCCGACAGGAAGTCGGATAAGCGAGACAGAAGGCTCGGCAAGAGCAAGGGC
TTCGGTTTCGTTTGCTTCAGCAGCCCCGATGATGCCACCAAGGCCGTGGCCGAGATGAACCAGCGCATGGTCAAC
GGCAAGCCCCTCTACGTCGCCCTGGCTCAGCGCAAGGACGTTCGCAAGAGCCAGCTGGAGGCCAGCATCCAGGCT
CGCAACCAGTTGCGCATGCAGCAGGCGGTGGCTGCTGCTGGTATGACACAGCAGTACATTCAGCCTCCCGTCTTC
TACGCCCCAGGCCAGCAGGCCGGATTCCTGCCTCAGGCCGGCCGTGGCATGGCCTTTCCCCAGCCGGCCATGGGC
ATGGGCGGCGTCCAGGGCGGTCGCCCGGGACAGTTCCCCGGATATCCCCAGCAAGGGGGTCGCGGCGGCGTCCCT
CAGCAGATGCCTCCCAGCATGTACGGCATGCCGGGCCAGTATCCGCCTCAGTACGGCCAGCCCGGAACGCCCCAG
TTCCTGGCGGCCATGCAGCAGGCCCAGCAAGCTGCAGCCCTCGCTGGCGGACGTGGAGGTCCTCAGGCCGGCCGG
GGCGGCATCCCCGGCGTACCCCCTGCGGCGCCGGCCGGCATGCCCGGCGCTGGCATGCCCGGCTTCCCTCCTAAC
AACCGGCAGCAGGGCGGCATGGGCCGCGGCGCCGGCGCCAATGGCGGTGGACGCAACGGCGGCTTCCCTAACCAA
GGTGGCCGTGGAGGCGACATGAACGCGACGGCCATGCTGCAGTCCCAGATCGCTGGAGCGCAGCCGGCTCAGCAG
AAGCAGCTCCTCGGCGAGATGATTTTCCCCAAGATCCAGGCCATTAACTCGGAGTTGGCGGGCAAGATCACGGGC
ATGCTCCTCGAAATGGAGAACTCGGAGCTCATCAATCTGTGAGTTGACAAGTCCATCACACGCTCGGCGTCGGAT
GACTGACGGCGGATCTTTACAGTATCGAGGATGAGTCTGCGCTCAAGGCCAAGGTGGACGAGGCTCTCACCGTCT
ACGACGAGTACATCAAGGGCCAGGGCGGTCCCGGGCCCGAGGGCCACGAGGGCAAGAAGGACGAGGCTCCCAAGA
TGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail