Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5115
Gene name
LocationContig_493:2646..5228
Strand-
Gene length (bp)2582
Transcript length (bp)2397
Coding sequence length (bp)2397
Protein length (aa) 799

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 6.0E-179 99 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 39 795 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 78 793 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 4 793 1.0E-176
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 44 781 4.0E-168
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 781 4.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 39 795 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 78 793 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 4 793 1.0E-176
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 44 781 4.0E-168
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 781 4.0E-166
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 70 770 7.0E-164
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 77 781 2.0E-162
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 35 769 4.0E-157
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 64 797 5.0E-151
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 77 770 5.0E-149
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 72 770 9.0E-144
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 64 768 7.0E-138
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 7 781 2.0E-131
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 12 768 7.0E-123
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 175 197 22
3 207 229 22
4 234 256 22
5 271 290 19
6 297 314 17
7 329 351 22
8 358 380 22
9 424 446 22
10 478 500 22
11 505 527 22
12 534 556 22
13 588 610 22
14 630 649 19
15 659 676 17
16 683 700 17
17 704 721 17
18 734 756 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5115
MVPSVFRKRHEPEEVTPIPAALESNASGVDHLKHLHEFEKAHKLDPNLPIDDLNDVDAAIAMGNAEKGIEIEHAL
MEDNSPYPEVRSVVRNYDVDVPVNTIRAWVIGMLLCSVGSSINMIFSLRYPSITITTYVVQLIAYPIGRGWDMVM
PDRVWNLCGLKFNLRPGKFNYKEHVIIVAMSNAAYGGGALYANDVIIAQKIFYGQDFGMAFQILFGITTLCTGYG
LAGLARRFLVWPAAMIWPADLVNCALFYTLHDHSTSDPTKTNGWSIGRYKLFLIIFCGGFFYYWFPGWIFKGLSL
FAWVCWLAPNNLVINKLFGVQHGYGLMPITFDWSIISGFINSPLIPPFHAIANVLGSIMIFFVIASIGIHFTGAL
YADYVPVQSSESYDNTGNVYNVSRVLDANYQFNETAYKEYSPLYLSTQFALSYGLSFAAMASVIIHVALYHGKEI
WRQFRMARHQEDDVHMRLMKKYRDAEDWWYAALFIVMVAVSFGVVTGWPTGFPPWAFVICLLLPIVWLIPIGLIQ
AITNIQLGLNVLTELIIGYMAPGRPLVMMLFKNYGYISMSQALYFAQDLKLGHYMKVPPRVMFSSQLVASIWSAT
LQICVLNWALRNIPEVCTVTQPNNYSCPNSRVFYTASIVWGVIGPARIFSHGATYASLRWFWLVGTLTPVATWLL
ARRWPKSFWRYVCTPIIFGGVGLLPPATVYIYLCWGVVGVIFGYFIKRRYTGWWLQYNYITSAALDCGLVCSTLV
IFFTLYLTSTSPPKWWGNEGIFKNLDHQNLAITKRLPPGETFGPSVYP*
Coding >Ophun1|5115
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCCGCTGCTCTCGAGTCCAAC
GCGTCGGGCGTCGACCATCTGAAGCATCTTCACGAATTTGAAAAGGCTCATAAACTCGATCCCAACTTGCCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGCAATGCCGAAAAGGGCATCGAGATCGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCCGCTCCGTCGTCCGCAACTACGACGTCGACGTCCCCGTAAACACC
ATCCGAGCCTGGGTCATCGGCATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTAT
CCAAGCATCACCATCACCACCTACGTAGTCCAGCTCATTGCTTATCCCATCGGCCGCGGTTGGGACATGGTCATG
CCGGACCGCGTCTGGAACCTCTGTGGCCTCAAGTTCAACCTCCGACCCGGCAAGTTCAATTACAAGGAGCACGTA
ATCATTGTCGCCATGTCCAATGCCGCGTACGGCGGAGGCGCTCTCTATGCCAACGACGTCATCATTGCTCAAAAG
ATCTTTTACGGTCAGGACTTTGGCATGGCCTTTCAGATTCTCTTCGGCATCACTACCCTCTGCACCGGCTATGGG
CTCGCCGGTCTGGCTCGCCGTTTCTTGGTTTGGCCGGCCGCCATGATCTGGCCAGCTGACCTTGTCAACTGTGCT
CTCTTTTACACCCTGCACGATCACTCGACCTCGGATCCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAG
CTGTTCCTCATCATCTTTTGCGGCGGCTTCTTCTACTACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTC
TTCGCCTGGGTCTGCTGGCTTGCCCCCAACAACCTGGTCATCAACAAGCTGTTTGGGGTCCAGCACGGCTATGGT
CTGATGCCCATCACCTTTGACTGGTCCATCATCAGCGGCTTCATCAACTCGCCCCTCATTCCGCCATTCCACGCC
ATCGCAAACGTCCTCGGGAGCATCATGATCTTCTTCGTCATCGCTTCCATCGGCATCCACTTTACTGGCGCTCTC
TACGCCGACTACGTGCCCGTTCAGTCGTCCGAGTCGTATGATAACACGGGCAACGTCTACAATGTCAGTCGCGTC
CTGGATGCCAACTATCAGTTCAACGAGACGGCATACAAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCC
CTGTCGTACGGTCTCTCCTTCGCCGCCATGGCCTCTGTCATTATCCACGTCGCTCTCTACCACGGCAAGGAGATC
TGGAGGCAGTTTAGGATGGCCCGCCACCAGGAGGACGACGTCCATATGCGCCTCATGAAAAAGTACCGCGACGCC
GAGGATTGGTGGTATGCCGCTCTGTTCATCGTCATGGTCGCCGTCTCGTTTGGTGTCGTCACCGGCTGGCCGACC
GGCTTCCCTCCCTGGGCCTTTGTCATCTGCCTGCTGCTGCCCATCGTCTGGCTCATCCCAATTGGTCTAATCCAG
GCCATCACCAACATTCAGCTCGGTCTCAACGTCCTCACGGAGCTCATCATTGGCTACATGGCCCCGGGCCGGCCG
CTAGTCATGATGCTGTTCAAGAACTACGGCTACATCTCCATGTCGCAGGCTCTCTACTTCGCACAGGATCTCAAG
CTCGGTCACTACATGAAGGTGCCTCCGCGCGTCATGTTCTCGTCGCAGCTGGTGGCCTCGATCTGGTCTGCCACG
CTGCAGATCTGCGTCCTCAACTGGGCGCTGCGCAACATCCCCGAAGTCTGCACCGTCACGCAGCCCAACAACTAC
AGCTGCCCCAACAGTCGCGTCTTCTACACGGCTTCCATCGTCTGGGGCGTCATCGGCCCCGCGCGCATCTTTAGC
CATGGGGCGACGTACGCCTCGCTGCGCTGGTTCTGGCTCGTCGGCACCTTGACCCCCGTCGCGACCTGGCTCCTG
GCCCGTCGCTGGCCCAAGTCGTTCTGGCGCTACGTCTGCACTCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCG
CCGGCCACCGTCTACATCTACTTGTGCTGGGGCGTCGTCGGCGTCATCTTTGGTTACTTCATCAAGCGTCGTTAT
ACCGGCTGGTGGTTGCAGTACAATTACATCACCTCGGCCGCTCTCGACTGCGGACTCGTCTGCTCGACTCTCGTC
ATCTTCTTCACCCTGTACCTGACTTCGACGAGCCCGCCCAAGTGGTGGGGCAACGAGGGCATCTTCAAGAACCTC
GATCATCAGAACCTGGCCATCACCAAGAGGCTACCGCCCGGAGAGACCTTTGGGCCGTCCGTCTATCCTTGA
Transcript >Ophun1|5115
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCCGCTGCTCTCGAGTCCAAC
GCGTCGGGCGTCGACCATCTGAAGCATCTTCACGAATTTGAAAAGGCTCATAAACTCGATCCCAACTTGCCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGCAATGCCGAAAAGGGCATCGAGATCGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCCGCTCCGTCGTCCGCAACTACGACGTCGACGTCCCCGTAAACACC
ATCCGAGCCTGGGTCATCGGCATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTAT
CCAAGCATCACCATCACCACCTACGTAGTCCAGCTCATTGCTTATCCCATCGGCCGCGGTTGGGACATGGTCATG
CCGGACCGCGTCTGGAACCTCTGTGGCCTCAAGTTCAACCTCCGACCCGGCAAGTTCAATTACAAGGAGCACGTA
ATCATTGTCGCCATGTCCAATGCCGCGTACGGCGGAGGCGCTCTCTATGCCAACGACGTCATCATTGCTCAAAAG
ATCTTTTACGGTCAGGACTTTGGCATGGCCTTTCAGATTCTCTTCGGCATCACTACCCTCTGCACCGGCTATGGG
CTCGCCGGTCTGGCTCGCCGTTTCTTGGTTTGGCCGGCCGCCATGATCTGGCCAGCTGACCTTGTCAACTGTGCT
CTCTTTTACACCCTGCACGATCACTCGACCTCGGATCCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAG
CTGTTCCTCATCATCTTTTGCGGCGGCTTCTTCTACTACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTC
TTCGCCTGGGTCTGCTGGCTTGCCCCCAACAACCTGGTCATCAACAAGCTGTTTGGGGTCCAGCACGGCTATGGT
CTGATGCCCATCACCTTTGACTGGTCCATCATCAGCGGCTTCATCAACTCGCCCCTCATTCCGCCATTCCACGCC
ATCGCAAACGTCCTCGGGAGCATCATGATCTTCTTCGTCATCGCTTCCATCGGCATCCACTTTACTGGCGCTCTC
TACGCCGACTACGTGCCCGTTCAGTCGTCCGAGTCGTATGATAACACGGGCAACGTCTACAATGTCAGTCGCGTC
CTGGATGCCAACTATCAGTTCAACGAGACGGCATACAAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCC
CTGTCGTACGGTCTCTCCTTCGCCGCCATGGCCTCTGTCATTATCCACGTCGCTCTCTACCACGGCAAGGAGATC
TGGAGGCAGTTTAGGATGGCCCGCCACCAGGAGGACGACGTCCATATGCGCCTCATGAAAAAGTACCGCGACGCC
GAGGATTGGTGGTATGCCGCTCTGTTCATCGTCATGGTCGCCGTCTCGTTTGGTGTCGTCACCGGCTGGCCGACC
GGCTTCCCTCCCTGGGCCTTTGTCATCTGCCTGCTGCTGCCCATCGTCTGGCTCATCCCAATTGGTCTAATCCAG
GCCATCACCAACATTCAGCTCGGTCTCAACGTCCTCACGGAGCTCATCATTGGCTACATGGCCCCGGGCCGGCCG
CTAGTCATGATGCTGTTCAAGAACTACGGCTACATCTCCATGTCGCAGGCTCTCTACTTCGCACAGGATCTCAAG
CTCGGTCACTACATGAAGGTGCCTCCGCGCGTCATGTTCTCGTCGCAGCTGGTGGCCTCGATCTGGTCTGCCACG
CTGCAGATCTGCGTCCTCAACTGGGCGCTGCGCAACATCCCCGAAGTCTGCACCGTCACGCAGCCCAACAACTAC
AGCTGCCCCAACAGTCGCGTCTTCTACACGGCTTCCATCGTCTGGGGCGTCATCGGCCCCGCGCGCATCTTTAGC
CATGGGGCGACGTACGCCTCGCTGCGCTGGTTCTGGCTCGTCGGCACCTTGACCCCCGTCGCGACCTGGCTCCTG
GCCCGTCGCTGGCCCAAGTCGTTCTGGCGCTACGTCTGCACTCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCG
CCGGCCACCGTCTACATCTACTTGTGCTGGGGCGTCGTCGGCGTCATCTTTGGTTACTTCATCAAGCGTCGTTAT
ACCGGCTGGTGGTTGCAGTACAATTACATCACCTCGGCCGCTCTCGACTGCGGACTCGTCTGCTCGACTCTCGTC
ATCTTCTTCACCCTGTACCTGACTTCGACGAGCCCGCCCAAGTGGTGGGGCAACGAGGGCATCTTCAAGAACCTC
GATCATCAGAACCTGGCCATCACCAAGAGGCTACCGCCCGGAGAGACCTTTGGGCCGTCCGTCTATCCTTGA
Gene >Ophun1|5115
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCCGCTGCTCTCGAGTCCAAC
GCGTCGGGCGTCGACCATCTGAAGCATCTTCACGAATTTGAAAAGGCTCATAAACTCGATCCCAACTTGCCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGCAATGCCGAAAAGGGCATCGAGATCGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCATGACTTTACCTACATCTATCTGTCTTCTTCAAAACCCCAATATC
GCTAACGGCCAAGAATAGGTCCGCTCCGTCGTCCGCAACTACGACGTCGACGTCCCCGTAAACACCATCCGAGCC
TGGGTCATCGGCATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTATCCAAGCATC
ACCATCACCACCTACGTAGTCCAGCTCATTGCTTATCCCATCGGCCGCGGTTGGGACATGGTCATGCCGGACCGC
GTCTGGAACCTCTGTGGCCTCAAGTTCAACCTCCGACCCGGCAAGTTCAATTACAAGGAGCACGTAATCATTGTC
GCCATGTCCAATGTGAGTCTTGTCGAAACCCTGGGGGAAATCCTTTGCTTTGCTGATGAGTTGAGTCCCAAAGGC
CGCGTACGGCGGAGGCGCTCTCTATGCCAACGACGTCATCATTGCTCAAAAGATCTTTTACGGTCAGGACTTTGG
CATGGCCTTTCAGATTCTCTTCGGCATCACTACCCTCTGCACCGGCTATGGGCTCGCCGGTCTGGCTCGCCGTTT
CTTGGTTTGGCCGGCCGCCATGATCTGGCCAGCTGACCTTGTCAACTGTGCTCTCTTTTACACCCTGCACGATCA
CTCGACCTCGGATCCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAGCTGTTCCTCATCATCTTTTGCGG
CGGCTTCTTCTACTACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTCTTCGCCTGGGTCTGCTGGCTTGC
CCCCAACAACCTGGTCATCAACAAGCTGTTTGGGGTCCAGCACGGCTATGGTCTGATGCCCATCACCTTTGACTG
GTCCATCATCAGCGGCTTCATCAACTCGCCCCTCATTCCGCCATTCCACGCCATCGCAAACGTCCTCGGGAGCAT
CATGATCTTCTTCGTCATCGCTTCCATCGGCATCCACTTTACTGGCGCTCTCTACGCCGACTACGTGCCCGTTCA
GTCGTCCGAGTCGTATGATAACACGGGCAACGTCTACAATGTCAGTCGCGTCCTGGATGCCAACTATCAGTTCAA
CGAGACGGCATACAAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCCCTGTCGTACGGTCTCTCCTTCGC
CGCCATGGCCTCTGTCATTATCCACGTCGCTCTCTACCACGGCAAGGAGATCTGGAGGCAGTTTAGGATGGCCCG
CCACCAGGAGGACGACGTCCATATGCGCCTCATGAAAAAGTACCGCGACGCCGAGGATTGGTGGTATGCCGGTAT
GTTCTGTCTATGCATCTTAGCCGTGTGAGCCTGCTGACCGCCTGCTTCTCCCAGCTCTGTTCATCGTCATGGTCG
CCGTCTCGTTTGGTGTCGTCACCGGCTGGCCGACCGGCTTCCCTCCCTGGGCCTTTGTCATCTGCCTGCTGCTGC
CCATCGTCTGGCTCATCCCAATTGGTCTAATCCAGGCCATCACCAACATTCAGCTCGGTCTCAACGTCCTCACGG
AGCTCATCATTGGCTACATGGCCCCGGGCCGGCCGCTAGTCATGATGCTGTTCAAGAACTACGGCTACATCTCCA
TGTCGCAGGCTCTCTACTTCGCACAGGATCTCAAGCTCGGTCACTACATGAAGGTGCCTCCGCGCGTCATGTTCT
CGTCGCAGCTGGTGGCCTCGATCTGGTCTGCCACGCTGCAGATCTGCGTCCTCAACTGGGCGCTGCGCAACATCC
CCGAAGTCTGCACCGTCACGCAGCCCAACAACTACAGCTGCCCCAACAGTCGCGTCTTCTACACGGCTTCCATCG
TCTGGGGCGTCATCGGCCCCGCGCGCATCTTTAGCCATGGGGCGACGTACGCCTCGCTGCGCTGGTTCTGGCTCG
TCGGCACCTTGACCCCCGTCGCGACCTGGCTCCTGGCCCGTCGCTGGCCCAAGTCGTTCTGGCGCTACGTCTGCA
CTCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCGCCGGCCACCGTCTACATCTACTTGTGCTGGGGCGTCGTCG
GCGTCATCTTTGGTTACTTCATCAAGCGTCGTTATACCGGCTGGTGGTTGCAGTACAATTACATCACCTCGGCCG
CTCTCGACTGCGGACTCGTCTGCTCGACTCTCGTCATCTTCTTCACCCTGTACCTGACTTCGACGAGCCCGCCCA
AGTGGTGGGGCAACGAGGGCATCTTCAAGAACCTCGATCATCAGAACCTGGCCATCACCAAGAGGCTACCGCCCG
GAGAGACCTTTGGGCCGTCCGTCTATCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail