Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5111
Gene name
LocationContig_492:4796..7247
Strand+
Gene length (bp)2451
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e 6.1E-31 71 199
PF13177 DNA_pol3_delta2 DNA polymerase III, delta subunit 2.8E-08 261 407
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.7E-06 260 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X082|RFC5_NEUCR Replication factor C subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.460 PE=3 SV=1 252 566 0.0E+00
sp|O94697|RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc5 PE=1 SV=1 252 566 7.0E-120
sp|Q8R323|RFC3_MOUSE Replication factor C subunit 3 OS=Mus musculus GN=Rfc3 PE=1 SV=1 253 561 7.0E-113
sp|Q2TBV1|RFC3_BOVIN Replication factor C subunit 3 OS=Bos taurus GN=RFC3 PE=2 SV=1 253 561 2.0E-110
sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2 253 561 3.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X082|RFC5_NEUCR Replication factor C subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.460 PE=3 SV=1 252 566 0.0E+00
sp|O94697|RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc5 PE=1 SV=1 252 566 7.0E-120
sp|Q8R323|RFC3_MOUSE Replication factor C subunit 3 OS=Mus musculus GN=Rfc3 PE=1 SV=1 253 561 7.0E-113
sp|Q2TBV1|RFC3_BOVIN Replication factor C subunit 3 OS=Bos taurus GN=RFC3 PE=2 SV=1 253 561 2.0E-110
sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2 253 561 3.0E-110
sp|Q54BN3|RFC3_DICDI Probable replication factor C subunit 3 OS=Dictyostelium discoideum GN=rfc3 PE=3 SV=1 253 560 6.0E-105
sp|Q8VXX4|RFC3_ARATH Replication factor C subunit 3 OS=Arabidopsis thaliana GN=RFC3 PE=2 SV=1 234 563 2.0E-98
sp|P38251|RFC5_YEAST Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC5 PE=1 SV=1 249 554 1.0E-97
sp|Q852K3|RFC5_ORYSJ Replication factor C subunit 5 OS=Oryza sativa subsp. japonica GN=RFC5 PE=2 SV=1 234 563 6.0E-93
sp|Q5UQE8|RFCS2_MIMIV Putative replication factor C small subunit L478 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L478 PE=3 SV=1 252 561 5.0E-35
sp|P38064|RM16_YEAST 54S ribosomal protein L16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL16 PE=1 SV=1 72 225 6.0E-35
sp|Q9Y822|RM16_SCHPO 54S ribosomal protein L16, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl16 PE=3 SV=1 43 211 5.0E-27
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 234 553 3.0E-24
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 234 560 6.0E-24
sp|Q8ZWS2|RFCS2_PYRAE Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 234 459 9.0E-24
sp|A4WLY0|RFCS2_PYRAR Replication factor C small subunit 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS2 PE=3 SV=1 234 459 2.0E-23
sp|A4WGV2|RFCS1_PYRAR Replication factor C small subunit 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS1 PE=3 SV=1 234 540 7.0E-23
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 234 553 2.0E-22
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 234 459 2.0E-22
sp|P40348|RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC2 PE=1 SV=1 251 479 3.0E-22
sp|Q975D3|RFCS_SULTO Replication factor C small subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcS PE=3 SV=1 256 561 3.0E-22
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 253 553 4.0E-22
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 252 558 1.0E-21
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 234 553 6.0E-21
sp|A2SQT3|RFCS_METLZ Replication factor C small subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcS PE=3 SV=1 242 555 9.0E-21
sp|A3CUX9|RFCS_METMJ Replication factor C small subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcS PE=3 SV=1 253 560 2.0E-20
sp|Q9UXF5|RFCS_SULSO Replication factor C small subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcS PE=1 SV=1 256 552 5.0E-20
sp|Q6L1I0|RFCS_PICTO Replication factor C small subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcS PE=3 SV=1 253 475 6.0E-20
sp|Q9FXM3|RFC2_ORYSJ Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 249 477 7.0E-20
sp|A6VJ61|RFCS_METM7 Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 257 553 8.0E-20
sp|Q9HI47|RFCS_THEAC Replication factor C small subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcS PE=3 SV=2 256 556 9.0E-20
sp|P0C7N7|RFC2_PHANO Replication factor C subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RFC2 PE=3 SV=1 240 449 1.0E-19
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 234 553 2.0E-19
sp|Q6M044|RFCS_METMP Replication factor C small subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcS PE=3 SV=1 257 553 2.0E-19
sp|A1RWU7|RFCS_THEPD Replication factor C small subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcS PE=3 SV=1 234 556 2.0E-19
sp|Q09843|RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc2 PE=1 SV=1 225 477 2.0E-19
sp|Q9HN27|RFCS_HALSA Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcS PE=3 SV=1 256 498 6.0E-19
sp|B0R7H7|RFCS_HALS3 Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcS PE=3 SV=1 256 498 6.0E-19
sp|A9A6K6|RFCS_METM6 Replication factor C small subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcS PE=3 SV=1 229 553 6.0E-19
sp|A7I8Y0|RFCS_METB6 Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 242 554 7.0E-19
sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 234 496 7.0E-19
sp|Q5UZE5|RFCS_HALMA Replication factor C small subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcS PE=3 SV=2 256 449 9.0E-19
sp|A4FZ74|RFCS_METM5 Replication factor C small subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcS PE=3 SV=1 229 459 1.0E-18
sp|Q8TSX5|RFCS_METAC Replication factor C small subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcS PE=3 SV=1 227 449 2.0E-18
sp|O28219|RFCS_ARCFU Replication factor C small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcS PE=1 SV=1 256 551 3.0E-18
sp|Q9CAM7|RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 250 558 3.0E-18
sp|Q8PVY4|RFCS_METMA Replication factor C small subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcS PE=3 SV=1 227 449 3.0E-18
sp|A6US36|RFCS_METVS Replication factor C small subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcS PE=3 SV=1 257 459 5.0E-18
sp|Q54MD4|RFC4_DICDI Probable replication factor C subunit 4 OS=Dictyostelium discoideum GN=rfc4 PE=3 SV=1 234 449 6.0E-18
sp|Q93ZX1|RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana GN=RFC4 PE=2 SV=1 251 449 1.0E-17
sp|Q99J62|RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 234 429 1.0E-17
sp|Q977Z9|RFCS_THEVO Replication factor C small subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcS PE=3 SV=2 256 556 2.0E-17
sp|O74111|RFC3_BLAAD Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 218 494 2.0E-17
sp|P38629|RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 222 479 2.0E-17
sp|P60374|RFCS_NANEQ Replication factor C small subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcS PE=3 SV=1 234 551 2.0E-17
sp|Q9D0F6|RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus GN=Rfc5 PE=1 SV=1 257 455 4.0E-17
sp|Q46C63|RFCS_METBF Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 227 449 6.0E-17
sp|Q3ITJ2|RFCS_NATPD Replication factor C small subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcS PE=3 SV=1 256 407 8.0E-17
sp|Q5JHP2|RFCS_THEKO Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 315 553 1.0E-16
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 315 556 1.0E-16
sp|B0T2C9|RL16_CAUSK 50S ribosomal protein L16 OS=Caulobacter sp. (strain K31) GN=rplP PE=3 SV=1 64 194 2.0E-16
sp|A1USM1|RL16_BARBK 50S ribosomal protein L16 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplP1 PE=3 SV=1 64 202 2.0E-16
sp|Q2FQT9|RFCS_METHJ Replication factor C small subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcS PE=3 SV=1 256 449 2.0E-16
sp|Q6G2X2|RL16_BARHE 50S ribosomal protein L16 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplP PE=3 SV=1 64 202 3.0E-16
sp|P34429|RFC5_CAEEL Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 227 407 3.0E-16
sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1 257 455 4.0E-16
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 315 553 6.0E-16
sp|Q6YZ54|RFC3_ORYSJ Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 257 459 8.0E-16
sp|Q9A8U6|RL16_CAUCR 50S ribosomal protein L16 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplP PE=3 SV=1 64 194 1.0E-15
sp|B8H4E1|RL16_CAUCN 50S ribosomal protein L16 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplP PE=3 SV=1 64 194 1.0E-15
sp|Q9CAQ8|RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 257 459 1.0E-15
sp|P53033|RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 250 449 2.0E-15
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 256 425 2.0E-15
sp|Q6FZC9|RL16_BARQU 50S ribosomal protein L16 OS=Bartonella quintana (strain Toulouse) GN=rplP PE=3 SV=1 64 202 3.0E-15
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 250 449 4.0E-15
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 250 449 5.0E-15
sp|A9IW18|RL16_BART1 50S ribosomal protein L16 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplP PE=3 SV=1 64 202 7.0E-15
sp|Q28UV3|RL16_JANSC 50S ribosomal protein L16 OS=Jannaschia sp. (strain CCS1) GN=rplP PE=3 SV=1 64 194 7.0E-15
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 240 449 8.0E-15
sp|A6X0C5|RL16_OCHA4 50S ribosomal protein L16 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplP PE=3 SV=1 64 202 9.0E-15
sp|A1TYK4|RL16_MARHV 50S ribosomal protein L16 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplP PE=3 SV=1 64 202 1.0E-14
sp|Q1GK27|RL16_RUEST 50S ribosomal protein L16 OS=Ruegeria sp. (strain TM1040) GN=rplP PE=3 SV=1 64 196 2.0E-14
sp|A1WHD2|RL16_VEREI 50S ribosomal protein L16 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplP PE=3 SV=1 64 194 2.0E-14
sp|Q5LW55|RL16_RUEPO 50S ribosomal protein L16 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplP PE=3 SV=1 64 194 2.0E-14
sp|Q11HQ9|RL16_CHESB 50S ribosomal protein L16 OS=Chelativorans sp. (strain BNC1) GN=rplP PE=3 SV=1 64 202 2.0E-14
sp|A5WCJ7|RL16_PSYWF 50S ribosomal protein L16 OS=Psychrobacter sp. (strain PRwf-1) GN=rplP PE=3 SV=1 64 194 3.0E-14
sp|Q8G081|RL16_BRUSU 50S ribosomal protein L16 OS=Brucella suis biovar 1 (strain 1330) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|B0CH25|RL16_BRUSI 50S ribosomal protein L16 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|A5VQZ9|RL16_BRUO2 50S ribosomal protein L16 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|Q8YHN3|RL16_BRUME 50S ribosomal protein L16 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|C0RJJ4|RL16_BRUMB 50S ribosomal protein L16 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|A9M5P3|RL16_BRUC2 50S ribosomal protein L16 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|P0C0Z3|RL16_BRUAB 50S ribosomal protein L16 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|P0C0Z4|RL16_BRUA2 50S ribosomal protein L16 OS=Brucella abortus (strain 2308) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|B2S672|RL16_BRUA1 50S ribosomal protein L16 OS=Brucella abortus (strain S19) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|A8LM61|RL16_DINSH 50S ribosomal protein L16 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplP PE=3 SV=1 64 194 3.0E-14
sp|B8IS92|RL16_METNO 50S ribosomal protein L16 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplP PE=3 SV=1 64 202 3.0E-14
sp|C1DAS4|RL16_LARHH 50S ribosomal protein L16 OS=Laribacter hongkongensis (strain HLHK9) GN=rplP PE=3 SV=1 64 194 3.0E-14
sp|O14003|RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 254 457 4.0E-14
sp|A1B034|RL16_PARDP 50S ribosomal protein L16 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplP PE=3 SV=1 64 194 5.0E-14
sp|B4R8M4|RL16_PHEZH 50S ribosomal protein L16 OS=Phenylobacterium zucineum (strain HLK1) GN=rplP PE=3 SV=1 64 207 5.0E-14
sp|B0UHW2|RL16_METS4 50S ribosomal protein L16 OS=Methylobacterium sp. (strain 4-46) GN=rplP PE=3 SV=1 64 202 6.0E-14
sp|A1TJ14|RL16_ACIAC 50S ribosomal protein L16 OS=Acidovorax citrulli (strain AAC00-1) GN=rplP PE=3 SV=1 64 194 6.0E-14
sp|B1LWT3|RL16_METRJ 50S ribosomal protein L16 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplP PE=3 SV=1 64 194 7.0E-14
sp|C5CP46|RL16_VARPS 50S ribosomal protein L16 OS=Variovorax paradoxus (strain S110) GN=rplP PE=3 SV=1 64 194 8.0E-14
sp|Q21RW5|RL16_RHOFT 50S ribosomal protein L16 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplP PE=3 SV=1 64 194 8.0E-14
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 240 414 1.0E-13
sp|A5EX92|RL16_DICNV 50S ribosomal protein L16 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplP PE=3 SV=1 64 199 1.0E-13
sp|O26343|RFCS_METTH Replication factor C small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcS PE=1 SV=1 258 554 1.0E-13
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 250 405 1.0E-13
sp|P53016|RFC4_CAEEL Replication factor C subunit 4 OS=Caenorhabditis elegans GN=rfc-4 PE=1 SV=1 234 550 1.0E-13
sp|A1W2R4|RL16_ACISJ 50S ribosomal protein L16 OS=Acidovorax sp. (strain JS42) GN=rplP PE=3 SV=1 64 194 1.0E-13
sp|B9MB80|RL16_ACIET 50S ribosomal protein L16 OS=Acidovorax ebreus (strain TPSY) GN=rplP PE=3 SV=1 64 194 1.0E-13
sp|P53034|RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster GN=RfC4 PE=2 SV=1 249 560 1.0E-13
sp|A9BPS5|RL16_DELAS 50S ribosomal protein L16 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplP PE=3 SV=1 64 194 2.0E-13
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 350 560 2.0E-13
sp|A1VIQ7|RL16_POLNA 50S ribosomal protein L16 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplP PE=3 SV=1 64 194 2.0E-13
sp|Q5UQ72|RFCS4_MIMIV Putative replication factor C small subunit L510 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R510 PE=3 SV=1 251 453 3.0E-13
sp|A4SUW8|RL16_POLSQ 50S ribosomal protein L16 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplP PE=3 SV=1 64 199 3.0E-13
sp|B1XSQ8|RL16_POLNS 50S ribosomal protein L16 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplP PE=3 SV=1 64 199 3.0E-13
sp|A5UMF3|RFCS_METS3 Replication factor C small subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcS PE=3 SV=1 258 457 3.0E-13
sp|Q605B9|RL16_METCA 50S ribosomal protein L16 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplP PE=3 SV=1 64 200 3.0E-13
sp|B9KL98|RL16_RHOSK 50S ribosomal protein L16 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplP PE=3 SV=1 64 194 3.0E-13
sp|Q3J5R5|RL16_RHOS4 50S ribosomal protein L16 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplP PE=3 SV=1 64 194 3.0E-13
sp|A3PGL8|RL16_RHOS1 50S ribosomal protein L16 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplP PE=3 SV=1 64 194 3.0E-13
sp|A1KB20|RL16_AZOSB 50S ribosomal protein L16 OS=Azoarcus sp. (strain BH72) GN=rplP PE=3 SV=1 64 194 4.0E-13
sp|A3Q989|RL16_SHELP 50S ribosomal protein L16 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplP PE=3 SV=1 64 202 4.0E-13
sp|Q12GW4|RL16_POLSJ 50S ribosomal protein L16 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplP PE=3 SV=1 64 194 4.0E-13
sp|Q16AE4|RL16_ROSDO 50S ribosomal protein L16 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplP PE=3 SV=1 64 194 4.0E-13
sp|Q4FUE9|RL16_PSYA2 50S ribosomal protein L16 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplP PE=3 SV=1 64 194 4.0E-13
sp|Q98N50|RL16_RHILO 50S ribosomal protein L16 OS=Rhizobium loti (strain MAFF303099) GN=rplP PE=3 SV=1 64 202 5.0E-13
sp|A8GYY3|RL16_SHEPA 50S ribosomal protein L16 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplP PE=3 SV=1 64 202 5.0E-13
sp|A1AVK7|RL16_RUTMC 50S ribosomal protein L16 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplP PE=3 SV=1 64 194 5.0E-13
sp|B1Z759|RL16_METPB 50S ribosomal protein L16 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplP PE=3 SV=1 64 194 6.0E-13
sp|A9W4Q8|RL16_METEP 50S ribosomal protein L16 OS=Methylobacterium extorquens (strain PA1) GN=rplP PE=3 SV=1 64 194 6.0E-13
sp|B7L0R8|RL16_METC4 50S ribosomal protein L16 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplP PE=3 SV=1 64 194 6.0E-13
sp|B0TM05|RL16_SHEHH 50S ribosomal protein L16 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplP PE=3 SV=1 64 202 6.0E-13
sp|Q1R0G8|RL16_CHRSD 50S ribosomal protein L16 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplP PE=3 SV=1 64 202 7.0E-13
sp|B5ELY6|RL16_ACIF5 50S ribosomal protein L16 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplP PE=3 SV=1 64 199 8.0E-13
sp|B7J474|RL16_ACIF2 50S ribosomal protein L16 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplP PE=3 SV=1 64 199 8.0E-13
sp|Q1QDH9|RL16_PSYCK 50S ribosomal protein L16 OS=Psychrobacter cryohalolentis (strain K5) GN=rplP PE=3 SV=1 64 194 9.0E-13
sp|A8GKJ0|RL16_SERP5 50S ribosomal protein L16 OS=Serratia proteamaculans (strain 568) GN=rplP PE=3 SV=1 64 202 1.0E-12
sp|Q54E21|RFC2_DICDI Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 252 556 1.0E-12
sp|Q18E75|RFCS_HALWD Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 315 557 1.0E-12
sp|Q2S919|RL16_HAHCH 50S ribosomal protein L16 OS=Hahella chejuensis (strain KCTC 2396) GN=rplP PE=3 SV=1 64 194 1.0E-12
sp|B5FG16|RL16_VIBFM 50S ribosomal protein L16 OS=Vibrio fischeri (strain MJ11) GN=rplP PE=3 SV=1 64 202 1.0E-12
sp|Q5E8A8|RL16_VIBF1 50S ribosomal protein L16 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplP PE=3 SV=1 64 202 1.0E-12
sp|Q54ST4|RFC5_DICDI Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 222 460 2.0E-12
sp|C3MAY7|RL16_RHISN 50S ribosomal protein L16 OS=Rhizobium sp. (strain NGR234) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|Q92QG3|RL16_RHIME 50S ribosomal protein L16 OS=Rhizobium meliloti (strain 1021) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|Q2K9K9|RL16_RHIEC 50S ribosomal protein L16 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|B3PWS8|RL16_RHIE6 50S ribosomal protein L16 OS=Rhizobium etli (strain CIAT 652) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|Q2N9B8|RL16_ERYLH 50S ribosomal protein L16 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplP PE=3 SV=1 64 194 2.0E-12
sp|C4K7B1|RL16_HAMD5 50S ribosomal protein L16 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplP PE=3 SV=1 64 194 2.0E-12
sp|B9JDT5|RL16_AGRRK 50S ribosomal protein L16 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|A5CXL1|RL16_VESOH 50S ribosomal protein L16 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplP PE=3 SV=1 64 194 2.0E-12
sp|B9JVP4|RL16_AGRVS 50S ribosomal protein L16 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|Q1GPA6|RL16_SPHAL 50S ribosomal protein L16 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplP PE=3 SV=1 64 194 2.0E-12
sp|B8GV51|RL16_THISH 50S ribosomal protein L16 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplP PE=3 SV=1 64 199 2.0E-12
sp|A7IFY8|RL16_XANP2 50S ribosomal protein L16 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplP PE=3 SV=1 64 202 2.0E-12
sp|A6U866|RL16_SINMW 50S ribosomal protein L16 OS=Sinorhizobium medicae (strain WSM419) GN=rplP PE=3 SV=1 64 202 3.0E-12
sp|B5ZYU2|RL16_RHILW 50S ribosomal protein L16 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplP PE=3 SV=1 64 202 3.0E-12
sp|Q1MID4|RL16_RHIL3 50S ribosomal protein L16 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplP PE=3 SV=1 64 202 3.0E-12
sp|B1JIW8|RL16_YERPY 50S ribosomal protein L16 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q664S8|RL16_YERPS 50S ribosomal protein L16 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|A4TGZ9|RL16_YERPP 50S ribosomal protein L16 OS=Yersinia pestis (strain Pestoides F) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q1CCV1|RL16_YERPN 50S ribosomal protein L16 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|A9R903|RL16_YERPG 50S ribosomal protein L16 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q8ZJA5|RL16_YERPE 50S ribosomal protein L16 OS=Yersinia pestis GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|B2K5M3|RL16_YERPB 50S ribosomal protein L16 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q1C2V4|RL16_YERPA 50S ribosomal protein L16 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|A7FNM8|RL16_YERP3 50S ribosomal protein L16 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|A1JS27|RL16_YERE8 50S ribosomal protein L16 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q31IX5|RL16_THICR 50S ribosomal protein L16 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplP PE=3 SV=1 64 199 3.0E-12
sp|Q0ANQ7|RL16_MARMM 50S ribosomal protein L16 OS=Maricaulis maris (strain MCS10) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q3SLP2|RL16_THIDA 50S ribosomal protein L16 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|P46173|RL16_BUCAK 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplP PE=3 SV=1 64 202 3.0E-12
sp|A9IIY9|RL16_BORPD 50S ribosomal protein L16 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|Q8K957|RL16_BUCAP 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplP PE=3 SV=1 64 202 3.0E-12
sp|A4WVK1|RL16_RHOS5 50S ribosomal protein L16 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplP PE=3 SV=1 64 194 3.0E-12
sp|B6JEU0|RL16_OLICO 50S ribosomal protein L16 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplP PE=3 SV=1 64 199 3.0E-12
sp|B5YG40|RL16_THEYD 50S ribosomal protein L16 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rplP PE=3 SV=1 64 207 3.0E-12
sp|Q39XZ9|RL16_GEOMG 50S ribosomal protein L16 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplP PE=3 SV=1 64 194 4.0E-12
sp|Q089P7|RL16_SHEFN 50S ribosomal protein L16 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplP PE=3 SV=1 64 202 4.0E-12
sp|Q12SV2|RL16_SHEDO 50S ribosomal protein L16 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplP PE=3 SV=1 64 202 4.0E-12
sp|Q2RQW7|RL16_RHORT 50S ribosomal protein L16 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplP PE=3 SV=1 64 199 4.0E-12
sp|A8GT62|RL16_RICRS 50S ribosomal protein L16 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|B0BUQ3|RL16_RICRO 50S ribosomal protein L16 OS=Rickettsia rickettsii (strain Iowa) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|Q0VSJ6|RL16_ALCBS 50S ribosomal protein L16 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|A8F2E0|RL16_RICM5 50S ribosomal protein L16 OS=Rickettsia massiliae (strain Mtu5) GN=rplP PE=3 SV=2 64 194 5.0E-12
sp|A5CCK5|RL16_ORITB 50S ribosomal protein L16 OS=Orientia tsutsugamushi (strain Boryong) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|C4K2H2|RL16_RICPU 50S ribosomal protein L16 OS=Rickettsia peacockii (strain Rustic) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|Q92GX3|RL16_RICCN 50S ribosomal protein L16 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|Q5NQ58|RL16_ZYMMO 50S ribosomal protein L16 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|A1S225|RL16_SHEAM 50S ribosomal protein L16 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplP PE=3 SV=1 64 194 5.0E-12
sp|B4F1J1|RL16_PROMH 50S ribosomal protein L16 OS=Proteus mirabilis (strain HI4320) GN=rplP PE=3 SV=1 64 202 5.0E-12
sp|Q8SQM0|RFC4_ENCCU Replication factor C subunit 4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RFC4 PE=1 SV=1 248 453 6.0E-12
sp|Q4UMS2|RL16_RICFE 50S ribosomal protein L16 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplP PE=3 SV=1 64 194 6.0E-12
sp|A8EZK9|RL16_RICCK 50S ribosomal protein L16 OS=Rickettsia canadensis (strain McKiel) GN=rplP PE=3 SV=1 64 194 6.0E-12
sp|Q37M36|RL16_RHOPS 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplP PE=3 SV=1 64 199 6.0E-12
sp|Q2L2B8|RL16_BORA1 50S ribosomal protein L16 OS=Bordetella avium (strain 197N) GN=rplP PE=3 SV=1 64 194 6.0E-12
sp|C3LRQ1|RL16_VIBCM 50S ribosomal protein L16 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplP PE=3 SV=1 64 202 6.0E-12
sp|Q9KNZ1|RL16_VIBCH 50S ribosomal protein L16 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplP PE=3 SV=1 64 202 6.0E-12
sp|A5F542|RL16_VIBC3 50S ribosomal protein L16 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplP PE=3 SV=1 64 202 6.0E-12
sp|P40339|RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 252 420 7.0E-12
sp|B4S098|RL16_ALTMD 50S ribosomal protein L16 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplP PE=3 SV=1 64 199 7.0E-12
sp|Q89J91|RL16_BRADU 50S ribosomal protein L16 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplP PE=3 SV=1 64 202 7.0E-12
sp|B6IRR3|RL16_RHOCS 50S ribosomal protein L16 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplP PE=3 SV=1 64 199 7.0E-12
sp|Q8UE25|RL16_AGRFC 50S ribosomal protein L16 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplP PE=3 SV=1 64 202 7.0E-12
sp|Q7VTC6|RL16_BORPE 50S ribosomal protein L16 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplP PE=3 SV=1 64 194 7.0E-12
sp|Q7W2E9|RL16_BORPA 50S ribosomal protein L16 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplP PE=3 SV=1 64 194 7.0E-12
sp|Q7WRB8|RL16_BORBR 50S ribosomal protein L16 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplP PE=3 SV=1 64 194 7.0E-12
sp|B6EPT2|RL16_ALISL 50S ribosomal protein L16 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplP PE=3 SV=1 64 202 7.0E-12
sp|A9ADK0|RL16_BURM1 50S ribosomal protein L16 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplP PE=3 SV=1 64 199 7.0E-12
sp|B3QBX3|RL16_RHOPT 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplP PE=3 SV=1 64 199 8.0E-12
sp|Q6N4U1|RL16_RHOPA 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplP PE=1 SV=1 64 199 8.0E-12
sp|Q7MPI1|RL16_VIBVY 50S ribosomal protein L16 OS=Vibrio vulnificus (strain YJ016) GN=rplP PE=3 SV=1 64 202 8.0E-12
sp|Q8DE46|RL16_VIBVU 50S ribosomal protein L16 OS=Vibrio vulnificus (strain CMCP6) GN=rplP PE=3 SV=1 64 202 8.0E-12
sp|Q2G8X3|RL16_NOVAD 50S ribosomal protein L16 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplP PE=3 SV=1 64 194 8.0E-12
sp|Q5P325|RL16_AROAE 50S ribosomal protein L16 OS=Aromatoleum aromaticum (strain EbN1) GN=rplP PE=3 SV=1 64 194 8.0E-12
sp|Q2NQM9|RL16_SODGM 50S ribosomal protein L16 OS=Sodalis glossinidius (strain morsitans) GN=rplP PE=3 SV=1 64 202 9.0E-12
sp|A5FZV8|RL16_ACICJ 50S ribosomal protein L16 OS=Acidiphilium cryptum (strain JF-5) GN=rplP PE=3 SV=1 64 194 9.0E-12
sp|Q87T06|RL16_VIBPA 50S ribosomal protein L16 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplP PE=3 SV=1 64 202 9.0E-12
sp|A7N0I4|RL16_VIBCB 50S ribosomal protein L16 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplP PE=3 SV=1 64 202 9.0E-12
sp|B9M6H1|RL16_GEODF 50S ribosomal protein L16 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplP PE=3 SV=1 64 205 9.0E-12
sp|Q0BJ39|RL16_BURCM 50S ribosomal protein L16 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplP PE=3 SV=1 64 194 9.0E-12
sp|B1YRD7|RL16_BURA4 50S ribosomal protein L16 OS=Burkholderia ambifaria (strain MC40-6) GN=rplP PE=3 SV=1 64 194 9.0E-12
sp|Q4AAE7|RL16_MYCHJ 50S ribosomal protein L16 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rplP PE=3 SV=1 89 198 1.0E-11
sp|Q4A8H8|RL16_MYCH7 50S ribosomal protein L16 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rplP PE=3 SV=1 89 198 1.0E-11
sp|Q601K7|RL16_MYCH2 50S ribosomal protein L16 OS=Mycoplasma hyopneumoniae (strain 232) GN=rplP PE=3 SV=1 89 198 1.0E-11
sp|A5IYX9|RL16_MYCAP 50S ribosomal protein L16 OS=Mycoplasma agalactiae (strain PG2) GN=rplP PE=3 SV=1 88 205 1.0E-11
sp|Q2W2J8|RL16_MAGSA 50S ribosomal protein L16 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplP PE=3 SV=1 64 199 1.0E-11
sp|Q7NQF9|RL16_CHRVO 50S ribosomal protein L16 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplP PE=3 SV=1 64 194 1.0E-11
sp|B3CT12|RL16_ORITI 50S ribosomal protein L16 OS=Orientia tsutsugamushi (strain Ikeda) GN=rplP PE=3 SV=1 64 194 1.0E-11
sp|A9FGJ3|RL16_SORC5 50S ribosomal protein L16 OS=Sorangium cellulosum (strain So ce56) GN=rplP PE=3 SV=1 64 203 1.0E-11
sp|B2VK57|RL16_ERWT9 50S ribosomal protein L16 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q0BUP3|RL16_GRABC 50S ribosomal protein L16 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplP PE=3 SV=1 64 199 1.0E-11
sp|Q3YWU6|RL16_SHISS 50S ribosomal protein L16 OS=Shigella sonnei (strain Ss046) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q0SZY9|RL16_SHIF8 50S ribosomal protein L16 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q32B38|RL16_SHIDS 50S ribosomal protein L16 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q31VW3|RL16_SHIBS 50S ribosomal protein L16 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B2U2T1|RL16_SHIB3 50S ribosomal protein L16 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7LRS9|RL16_ESCF3 50S ribosomal protein L16 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q1R613|RL16_ECOUT 50S ribosomal protein L16 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B1LHC7|RL16_ECOSM 50S ribosomal protein L16 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B6I227|RL16_ECOSE 50S ribosomal protein L16 OS=Escherichia coli (strain SE11) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7NDT4|RL16_ECOLU 50S ribosomal protein L16 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|P0ADY7|RL16_ECOLI 50S ribosomal protein L16 OS=Escherichia coli (strain K12) GN=rplP PE=1 SV=1 64 202 1.0E-11
sp|B1IPY6|RL16_ECOLC 50S ribosomal protein L16 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|P0ADY8|RL16_ECOL6 50S ribosomal protein L16 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q0TCE8|RL16_ECOL5 50S ribosomal protein L16 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|A1AGK1|RL16_ECOK1 50S ribosomal protein L16 OS=Escherichia coli O1:K1 / APEC GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|A8A5B8|RL16_ECOHS 50S ribosomal protein L16 OS=Escherichia coli O9:H4 (strain HS) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B1X6G5|RL16_ECODH 50S ribosomal protein L16 OS=Escherichia coli (strain K12 / DH10B) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|C4ZUG8|RL16_ECOBW 50S ribosomal protein L16 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7M1M7|RL16_ECO8A 50S ribosomal protein L16 OS=Escherichia coli O8 (strain IAI1) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7N197|RL16_ECO81 50S ribosomal protein L16 OS=Escherichia coli O81 (strain ED1a) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7NLN2|RL16_ECO7I 50S ribosomal protein L16 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B5YTN4|RL16_ECO5E 50S ribosomal protein L16 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|P0ADY9|RL16_ECO57 50S ribosomal protein L16 OS=Escherichia coli O157:H7 GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7L4K2|RL16_ECO55 50S ribosomal protein L16 OS=Escherichia coli (strain 55989 / EAEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7MCS8|RL16_ECO45 50S ribosomal protein L16 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B7UK37|RL16_ECO27 50S ribosomal protein L16 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|A7ZSK2|RL16_ECO24 50S ribosomal protein L16 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|A8AQK9|RL16_CITK8 50S ribosomal protein L16 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q4FLM5|RL16_PELUB 50S ribosomal protein L16 OS=Pelagibacter ubique (strain HTCC1062) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|B2JI59|RL16_BURP8 50S ribosomal protein L16 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplP PE=3 SV=1 64 194 1.0E-11
sp|C6DG67|RL16_PECCP 50S ribosomal protein L16 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q6CZX7|RL16_PECAS 50S ribosomal protein L16 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplP PE=3 SV=1 64 202 1.0E-11
sp|Q0BYC1|RL16_HYPNA 50S ribosomal protein L16 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplP PE=3 SV=1 64 194 1.0E-11
sp|Q7MYF8|RL16_PHOLL 50S ribosomal protein L16 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|Q83PY6|RL16_SHIFL 50S ribosomal protein L16 OS=Shigella flexneri GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|Q2LQB3|RL16_SYNAS 50S ribosomal protein L16 OS=Syntrophus aciditrophicus (strain SB) GN=rplP PE=3 SV=1 64 194 2.0E-11
sp|Q89A73|RL16_BUCBP 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|A4YSJ9|RL16_BRASO 50S ribosomal protein L16 OS=Bradyrhizobium sp. (strain ORS278) GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|Q1RHM8|RL16_RICBR 50S ribosomal protein L16 OS=Rickettsia bellii (strain RML369-C) GN=rplP PE=3 SV=1 64 194 2.0E-11
sp|A8GVC1|RL16_RICB8 50S ribosomal protein L16 OS=Rickettsia bellii (strain OSU 85-389) GN=rplP PE=3 SV=1 64 194 2.0E-11
sp|Q82X82|RL16_NITEU 50S ribosomal protein L16 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplP PE=3 SV=1 64 199 2.0E-11
sp|Q1H4N0|RL16_METFK 50S ribosomal protein L16 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplP PE=3 SV=1 64 199 2.0E-11
sp|B2V7K6|RL16_SULSY 50S ribosomal protein L16 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplP PE=3 SV=1 62 194 2.0E-11
sp|A8IAR0|RL16_AZOC5 50S ribosomal protein L16 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|Q1IX79|RL16_DEIGD 50S ribosomal protein L16 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplP PE=3 SV=1 64 202 2.0E-11
sp|B7VLF0|RL16_VIBTL 50S ribosomal protein L16 OS=Vibrio tasmaniensis (strain LGP32) GN=rplP PE=3 SV=1 64 202 3.0E-11
sp|A2SLF0|RL16_METPP 50S ribosomal protein L16 OS=Methylibium petroleiphilum (strain PM1) GN=rplP PE=3 SV=1 64 202 3.0E-11
sp|Q07KM5|RL16_RHOP5 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplP PE=3 SV=1 64 199 3.0E-11
sp|Q8PC43|RL16_XANCP 50S ribosomal protein L16 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplP PE=3 SV=1 64 193 3.0E-11
sp|B0RU75|RL16_XANCB 50S ribosomal protein L16 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplP PE=3 SV=1 64 193 3.0E-11
sp|Q4URE6|RL16_XANC8 50S ribosomal protein L16 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplP PE=3 SV=1 64 193 3.0E-11
sp|Q2SU34|RL16_BURTA 50S ribosomal protein L16 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|Q63Q18|RL16_BURPS 50S ribosomal protein L16 OS=Burkholderia pseudomallei (strain K96243) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A3NEH2|RL16_BURP6 50S ribosomal protein L16 OS=Burkholderia pseudomallei (strain 668) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|Q3JMS0|RL16_BURP1 50S ribosomal protein L16 OS=Burkholderia pseudomallei (strain 1710b) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A3P0A6|RL16_BURP0 50S ribosomal protein L16 OS=Burkholderia pseudomallei (strain 1106a) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A1V896|RL16_BURMS 50S ribosomal protein L16 OS=Burkholderia mallei (strain SAVP1) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|Q62GL2|RL16_BURMA 50S ribosomal protein L16 OS=Burkholderia mallei (strain ATCC 23344) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A2S7I3|RL16_BURM9 50S ribosomal protein L16 OS=Burkholderia mallei (strain NCTC 10229) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A3MRW1|RL16_BURM7 50S ribosomal protein L16 OS=Burkholderia mallei (strain NCTC 10247) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|B2KEL4|RL16_ELUMP 50S ribosomal protein L16 OS=Elusimicrobium minutum (strain Pei191) GN=rplP PE=3 SV=1 79 194 3.0E-11
sp|Q1LI44|RL16_CUPMC 50S ribosomal protein L16 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|B9LJD9|RL16_CHLSY 50S ribosomal protein L16 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A9WH73|RL16_CHLAA 50S ribosomal protein L16 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A8GPE3|RL16_RICAH 50S ribosomal protein L16 OS=Rickettsia akari (strain Hartford) GN=rplP PE=3 SV=1 64 194 3.0E-11
sp|A4JAP7|RL16_BURVG 50S ribosomal protein L16 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|Q39KG0|RL16_BURL3 50S ribosomal protein L16 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|B4E5C7|RL16_BURCJ 50S ribosomal protein L16 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|A0K3N2|RL16_BURCH 50S ribosomal protein L16 OS=Burkholderia cenocepacia (strain HI2424) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|B1JU29|RL16_BURCC 50S ribosomal protein L16 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|Q1BRV5|RL16_BURCA 50S ribosomal protein L16 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|Q6F7R9|RL16_ACIAD 50S ribosomal protein L16 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|C3PPA0|RL16_RICAE 50S ribosomal protein L16 OS=Rickettsia africae (strain ESF-5) GN=rplP PE=3 SV=1 64 194 4.0E-11
sp|Q0AII8|RL16_NITEC 50S ribosomal protein L16 OS=Nitrosomonas eutropha (strain C91) GN=rplP PE=3 SV=1 64 199 4.0E-11
sp|Q0AUI7|RL16_SYNWW 50S ribosomal protein L16 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplP PE=3 SV=1 84 202 4.0E-11
sp|Q5GWU1|RL16_XANOR 50S ribosomal protein L16 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|B2SQR7|RL16_XANOP 50S ribosomal protein L16 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|Q2NZZ2|RL16_XANOM 50S ribosomal protein L16 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|Q3BWX6|RL16_XANC5 50S ribosomal protein L16 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|Q8PNR8|RL16_XANAC 50S ribosomal protein L16 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|Q2IXQ3|RL16_RHOP2 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplP PE=3 SV=1 64 199 4.0E-11
sp|A6TEW5|RL16_KLEP7 50S ribosomal protein L16 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplP PE=3 SV=1 64 202 4.0E-11
sp|B5XNA1|RL16_KLEP3 50S ribosomal protein L16 OS=Klebsiella pneumoniae (strain 342) GN=rplP PE=3 SV=1 64 202 4.0E-11
sp|A4WFC1|RL16_ENT38 50S ribosomal protein L16 OS=Enterobacter sp. (strain 638) GN=rplP PE=3 SV=1 64 202 4.0E-11
sp|Q87E75|RL16_XYLFT 50S ribosomal protein L16 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|B0U5K6|RL16_XYLFM 50S ribosomal protein L16 OS=Xylella fastidiosa (strain M12) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|Q9PE69|RL16_XYLFA 50S ribosomal protein L16 OS=Xylella fastidiosa (strain 9a5c) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|B2I8H6|RL16_XYLF2 50S ribosomal protein L16 OS=Xylella fastidiosa (strain M23) GN=rplP PE=3 SV=1 64 193 4.0E-11
sp|A9H3P2|RL16_GLUDA 50S ribosomal protein L16 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplP PE=3 SV=1 64 199 5.0E-11
sp|Q1QN23|RL16_NITHX 50S ribosomal protein L16 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplP PE=3 SV=1 64 199 5.0E-11
sp|Q15YN2|RL16_PSEA6 50S ribosomal protein L16 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplP PE=3 SV=1 64 199 5.0E-11
sp|C6E4Q0|RL16_GEOSM 50S ribosomal protein L16 OS=Geobacter sp. (strain M21) GN=rplP PE=3 SV=1 64 194 5.0E-11
sp|B5EFQ7|RL16_GEOBB 50S ribosomal protein L16 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplP PE=3 SV=1 64 194 5.0E-11
sp|Q5FTZ0|RL16_GLUOX 50S ribosomal protein L16 OS=Gluconobacter oxydans (strain 621H) GN=rplP PE=3 SV=1 64 205 6.0E-11
sp|A0T0Y0|RK16_THAPS 50S ribosomal protein L16, chloroplastic OS=Thalassiosira pseudonana GN=rpl16 PE=3 SV=1 64 204 6.0E-11
sp|Q3J8S1|RL16_NITOC 50S ribosomal protein L16 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplP PE=3 SV=1 64 194 6.0E-11
sp|B3R7R6|RL16_CUPTR 50S ribosomal protein L16 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplP PE=3 SV=1 64 194 7.0E-11
sp|Q46WF1|RL16_CUPPJ 50S ribosomal protein L16 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplP PE=3 SV=1 64 194 7.0E-11
sp|Q0K626|RL16_CUPNH 50S ribosomal protein L16 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplP PE=3 SV=1 64 194 7.0E-11
sp|C5BGL8|RL16_EDWI9 50S ribosomal protein L16 OS=Edwardsiella ictaluri (strain 93-146) GN=rplP PE=3 SV=1 64 202 7.0E-11
sp|A3DJH9|RL16_CLOTH 50S ribosomal protein L16 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rplP PE=3 SV=1 64 204 9.0E-11
sp|Q8XV19|RL16_RALSO 50S ribosomal protein L16 OS=Ralstonia solanacearum (strain GMI1000) GN=rplP PE=3 SV=1 64 194 9.0E-11
sp|B2UEL2|RL16_RALPJ 50S ribosomal protein L16 OS=Ralstonia pickettii (strain 12J) GN=rplP PE=3 SV=1 64 194 9.0E-11
sp|Q7CPL4|RL16_SALTY 50S ribosomal protein L16 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|Q8XET6|RL16_SALTI 50S ribosomal protein L16 OS=Salmonella typhi GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B4TXD5|RL16_SALSV 50S ribosomal protein L16 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B5BGX9|RL16_SALPK 50S ribosomal protein L16 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|C0Q0A9|RL16_SALPC 50S ribosomal protein L16 OS=Salmonella paratyphi C (strain RKS4594) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|A9MSZ1|RL16_SALPB 50S ribosomal protein L16 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|Q5PIV0|RL16_SALPA 50S ribosomal protein L16 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B4SUT3|RL16_SALNS 50S ribosomal protein L16 OS=Salmonella newport (strain SL254) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B4TKK8|RL16_SALHS 50S ribosomal protein L16 OS=Salmonella heidelberg (strain SL476) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B5RH22|RL16_SALG2 50S ribosomal protein L16 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B5R284|RL16_SALEP 50S ribosomal protein L16 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B5FJK7|RL16_SALDC 50S ribosomal protein L16 OS=Salmonella dublin (strain CT_02021853) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|Q57J39|RL16_SALCH 50S ribosomal protein L16 OS=Salmonella choleraesuis (strain SC-B67) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|A9MN55|RL16_SALAR 50S ribosomal protein L16 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|B5F7T8|RL16_SALA4 50S ribosomal protein L16 OS=Salmonella agona (strain SL483) GN=rplP PE=3 SV=1 64 202 9.0E-11
sp|Q890P5|RL16_CLOTE 50S ribosomal protein L16 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplP PE=3 SV=1 64 209 9.0E-11
sp|Q057B1|RL16_BUCCC 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplP PE=3 SV=1 64 194 9.0E-11
sp|A8ESV0|RL16_ARCB4 50S ribosomal protein L16 OS=Arcobacter butzleri (strain RM4018) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q211F5|RL16_RHOPB 50S ribosomal protein L16 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplP PE=3 SV=1 64 199 1.0E-10
sp|Q3SSV9|RL16_NITWN 50S ribosomal protein L16 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplP PE=3 SV=1 64 199 1.0E-10
sp|B6J5D9|RL16_COXB1 50S ribosomal protein L16 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplP PE=3 SV=1 64 202 1.0E-10
sp|Q83ER9|RL16_COXBU 50S ribosomal protein L16 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplP PE=3 SV=1 64 202 1.0E-10
sp|A9KD24|RL16_COXBN 50S ribosomal protein L16 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplP PE=3 SV=1 64 202 1.0E-10
sp|B6J256|RL16_COXB2 50S ribosomal protein L16 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplP PE=3 SV=1 64 202 1.0E-10
sp|Q68W85|RL16_RICTY 50S ribosomal protein L16 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q9ZCR2|RL16_RICPR 50S ribosomal protein L16 OS=Rickettsia prowazekii (strain Madrid E) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q5QXY4|RL16_IDILO 50S ribosomal protein L16 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplP PE=3 SV=1 64 199 1.0E-10
sp|Q13TH7|RL16_BURXL 50S ribosomal protein L16 OS=Burkholderia xenovorans (strain LB400) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|B2T744|RL16_BURPP 50S ribosomal protein L16 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|A5V5Z5|RL16_SPHWW 50S ribosomal protein L16 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q5WZK5|RL16_LEGPL 50S ribosomal protein L16 OS=Legionella pneumophila (strain Lens) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q5ZYN6|RL16_LEGPH 50S ribosomal protein L16 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|A5IHQ7|RL16_LEGPC 50S ribosomal protein L16 OS=Legionella pneumophila (strain Corby) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q5X852|RL16_LEGPA 50S ribosomal protein L16 OS=Legionella pneumophila (strain Paris) GN=rplP PE=3 SV=1 64 194 1.0E-10
sp|Q9RXJ5|RL16_DEIRA 50S ribosomal protein L16 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplP PE=1 SV=3 64 202 1.0E-10
sp|A9NAN1|RL16_COXBR 50S ribosomal protein L16 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplP PE=3 SV=1 64 202 1.0E-10
sp|Q3IF18|RL16_PSEHT 50S ribosomal protein L16 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplP PE=3 SV=1 64 199 1.0E-10
sp|B8ELF6|RL16_METSB 50S ribosomal protein L16 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplP PE=3 SV=1 64 202 2.0E-10
sp|Q04C08|RL16_LACDB 50S ribosomal protein L16 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplP PE=3 SV=1 64 214 2.0E-10
sp|Q1GBL1|RL16_LACDA 50S ribosomal protein L16 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplP PE=3 SV=1 64 214 2.0E-10
sp|A5GAX2|RL16_GEOUR 50S ribosomal protein L16 OS=Geobacter uraniireducens (strain Rf4) GN=rplP PE=3 SV=1 64 205 2.0E-10
sp|A8ZV64|RL16_DESOH 50S ribosomal protein L16 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplP PE=3 SV=1 64 205 2.0E-10
sp|B1Y8I0|RL16_LEPCP 50S ribosomal protein L16 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplP PE=3 SV=1 63 199 2.0E-10
sp|O24696|RL16_SYNP6 50S ribosomal protein L16 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplP PE=3 SV=1 64 194 2.0E-10
sp|Q31L14|RL16_SYNE7 50S ribosomal protein L16 OS=Synechococcus elongatus (strain PCC 7942) GN=rplP PE=3 SV=1 64 194 2.0E-10
sp|Q7UN13|RL16_RHOBA 50S ribosomal protein L16 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplP PE=3 SV=1 64 205 3.0E-10
sp|Q7M8E1|RL16_WOLSU 50S ribosomal protein L16 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplP PE=3 SV=1 64 194 3.0E-10
sp|A0T0I6|RK16_PHATC 50S ribosomal protein L16, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl16 PE=3 SV=1 64 199 3.0E-10
sp|Q488A0|RL16_COLP3 50S ribosomal protein L16 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplP PE=3 SV=1 64 199 3.0E-10
sp|B2FQ52|RL16_STRMK 50S ribosomal protein L16 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplP PE=3 SV=1 64 193 3.0E-10
sp|Q6LVA9|RL16_PHOPR 50S ribosomal protein L16 OS=Photobacterium profundum GN=rplP PE=3 SV=1 64 194 3.0E-10
sp|B8G6R8|RL16_CHLAD 50S ribosomal protein L16 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplP PE=3 SV=1 64 194 3.0E-10
sp|A0RM18|RL16_CAMFF 50S ribosomal protein L16 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplP PE=3 SV=1 64 202 3.0E-10
sp|C1F635|RL16_ACIC5 50S ribosomal protein L16 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplP PE=3 SV=1 64 204 4.0E-10
sp|P49553|RK16_ODOSI 50S ribosomal protein L16, chloroplastic OS=Odontella sinensis GN=rpl16 PE=3 SV=1 64 199 4.0E-10
sp|Q5GSV1|RL16_WOLTR 50S ribosomal protein L16 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplP PE=3 SV=1 66 199 4.0E-10
sp|P56364|RK16_CHLVU 50S ribosomal protein L16, chloroplastic OS=Chlorella vulgaris GN=rpl16 PE=3 SV=1 64 194 4.0E-10
sp|A7HWR8|RL16_PARL1 50S ribosomal protein L16 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplP PE=3 SV=1 64 194 4.0E-10
sp|B2GDW2|RL16_LACF3 50S ribosomal protein L16 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplP PE=3 SV=1 64 194 4.0E-10
sp|A5N4Q4|RL16_CLOK5 50S ribosomal protein L16 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplP PE=3 SV=1 64 209 4.0E-10
sp|B9DYB6|RL16_CLOK1 50S ribosomal protein L16 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplP PE=3 SV=1 64 209 4.0E-10
sp|B8HMR1|RL16_CYAP4 50S ribosomal protein L16 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplP PE=3 SV=1 64 194 5.0E-10
sp|Q21M50|RL16_SACD2 50S ribosomal protein L16 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplP PE=3 SV=1 64 202 5.0E-10
sp|B7K241|RL16_CYAP8 50S ribosomal protein L16 OS=Cyanothece sp. (strain PCC 8801) GN=rplP PE=3 SV=1 64 204 5.0E-10
sp|A0L5Y0|RL16_MAGMM 50S ribosomal protein L16 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplP PE=3 SV=1 64 199 5.0E-10
sp|Q9XD29|RL16_LEPIN 50S ribosomal protein L16 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplP PE=3 SV=1 64 202 5.0E-10
sp|Q72NG8|RL16_LEPIC 50S ribosomal protein L16 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplP PE=3 SV=1 64 202 5.0E-10
sp|Q2NH89|RFCS_METST Replication factor C small subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcS PE=3 SV=1 257 558 5.0E-10
sp|A4G9T1|RL16_HERAR 50S ribosomal protein L16 OS=Herminiimonas arsenicoxydans GN=rplP PE=3 SV=1 64 194 6.0E-10
sp|Q03PW4|RL16_LACBA 50S ribosomal protein L16 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplP PE=3 SV=1 64 194 6.0E-10
sp|A6T3J7|RL16_JANMA 50S ribosomal protein L16 OS=Janthinobacterium sp. (strain Marseille) GN=rplP PE=3 SV=1 64 194 6.0E-10
sp|Q2JIM0|RL16_SYNJB 50S ribosomal protein L16 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplP PE=3 SV=1 64 204 7.0E-10
sp|Q74L82|RL16_LACJO 50S ribosomal protein L16 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplP PE=3 SV=1 64 202 7.0E-10
sp|B3E0J1|RL16_METI4 50S ribosomal protein L16 OS=Methylacidiphilum infernorum (isolate V4) GN=rplP PE=3 SV=1 70 194 7.0E-10
sp|B2G8X1|RL16_LACRJ 50S ribosomal protein L16 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplP PE=3 SV=1 64 194 7.0E-10
sp|A5VLJ8|RL16_LACRD 50S ribosomal protein L16 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplP PE=3 SV=1 64 194 7.0E-10
sp|B4SKX0|RL16_STRM5 50S ribosomal protein L16 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplP PE=3 SV=1 64 193 8.0E-10
sp|B0SSH0|RL16_LEPBP 50S ribosomal protein L16 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplP PE=3 SV=1 64 202 9.0E-10
sp|B0SA40|RL16_LEPBA 50S ribosomal protein L16 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplP PE=3 SV=1 64 202 9.0E-10
sp|Q055D7|RL16_LEPBL 50S ribosomal protein L16 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rplP1 PE=3 SV=1 64 202 9.0E-10
sp|Q04PU5|RL16_LEPBJ 50S ribosomal protein L16 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplP PE=3 SV=1 64 202 9.0E-10
sp|B7KHZ4|RL16_CYAP7 50S ribosomal protein L16 OS=Cyanothece sp. (strain PCC 7424) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q6MJ21|RL16_BDEBA 50S ribosomal protein L16 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|A1KRI0|RL16_NEIMF 50S ribosomal protein L16 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q7DDT4|RL16_NEIMB 50S ribosomal protein L16 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q9JR26|RL16_NEIMA 50S ribosomal protein L16 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|A9M3V9|RL16_NEIM0 50S ribosomal protein L16 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q5F5T4|RL16_NEIG1 50S ribosomal protein L16 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q30TV7|RL16_SULDN 50S ribosomal protein L16 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|Q046B8|RL16_LACGA 50S ribosomal protein L16 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplP PE=3 SV=1 64 202 1.0E-09
sp|B7J250|RL16_BORBZ 50S ribosomal protein L16 OS=Borrelia burgdorferi (strain ZS7) GN=rplP PE=3 SV=1 64 204 1.0E-09
sp|O51438|RL16_BORBU 50S ribosomal protein L16 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplP PE=3 SV=1 64 204 1.0E-09
sp|Q88XX9|RL16_LACPL 50S ribosomal protein L16 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplP PE=3 SV=1 64 194 1.0E-09
sp|B1KSL8|RL16_CLOBM 50S ribosomal protein L16 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|A7GJ67|RL16_CLOBL 50S ribosomal protein L16 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|B1IGE7|RL16_CLOBK 50S ribosomal protein L16 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|C1FMU4|RL16_CLOBJ 50S ribosomal protein L16 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|A5I7J9|RL16_CLOBH 50S ribosomal protein L16 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|C3KVP4|RL16_CLOB6 50S ribosomal protein L16 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|A7FZ62|RL16_CLOB1 50S ribosomal protein L16 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplP PE=3 SV=1 64 209 1.0E-09
sp|Q2GL52|RL16_ANAPZ 50S ribosomal protein L16 OS=Anaplasma phagocytophilum (strain HZ) GN=rplP PE=3 SV=1 66 203 1.0E-09
sp|P73313|RL16_SYNY3 50S ribosomal protein L16 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplP PE=3 SV=1 64 199 1.0E-09
sp|Q0SN22|RL16_BORAP 50S ribosomal protein L16 OS=Borrelia afzelii (strain PKo) GN=rplP PE=3 SV=1 64 204 1.0E-09
sp|B2S0I8|RL16_BORHD 50S ribosomal protein L16 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplP PE=3 SV=1 64 204 1.0E-09
sp|B2UMT2|RL16_AKKM8 50S ribosomal protein L16 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplP PE=3 SV=1 64 193 2.0E-09
sp|B0K5Q0|RL16_THEPX 50S ribosomal protein L16 OS=Thermoanaerobacter sp. (strain X514) GN=rplP PE=3 SV=1 64 202 2.0E-09
sp|Q8EUB9|RL16_MYCPE 50S ribosomal protein L16 OS=Mycoplasma penetrans (strain HF-2) GN=rplP PE=3 SV=1 64 204 2.0E-09
sp|Q8D205|RL16_WIGBR 50S ribosomal protein L16 OS=Wigglesworthia glossinidia brevipalpis GN=rplP PE=3 SV=1 64 202 2.0E-09
sp|B5ZB47|RL16_UREU1 50S ribosomal protein L16 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rplP PE=3 SV=1 80 205 2.0E-09
sp|A0LIJ7|RL16_SYNFM 50S ribosomal protein L16 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplP PE=3 SV=1 64 204 2.0E-09
sp|Q661D5|RL16_BORBP 50S ribosomal protein L16 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplP PE=3 SV=1 64 204 2.0E-09
sp|Q748Z5|RL16_GEOSL 50S ribosomal protein L16 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplP PE=3 SV=1 64 205 2.0E-09
sp|Q2RFQ4|RL16_MOOTA 50S ribosomal protein L16 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplP PE=3 SV=1 84 205 2.0E-09
sp|B0KCK7|RL16_THEP3 50S ribosomal protein L16 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplP PE=3 SV=1 64 202 2.0E-09
sp|Q2YAZ0|RL16_NITMU 50S ribosomal protein L16 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplP PE=3 SV=1 65 194 2.0E-09
sp|A0PXV3|RL16_CLONN 50S ribosomal protein L16 OS=Clostridium novyi (strain NT) GN=rplP PE=3 SV=1 64 204 2.0E-09
sp|A1ALU8|RL16_PELPD 50S ribosomal protein L16 OS=Pelobacter propionicus (strain DSM 2379) GN=rplP PE=3 SV=1 64 194 3.0E-09
sp|A8Z675|RL16_SULMW 50S ribosomal protein L16 OS=Sulcia muelleri (strain GWSS) GN=rplP PE=3 SV=1 64 199 3.0E-09
sp|B5RPI9|RL16_BORRA 50S ribosomal protein L16 OS=Borrelia recurrentis (strain A1) GN=rplP PE=3 SV=1 64 204 4.0E-09
sp|Q493K1|RL16_BLOPB 50S ribosomal protein L16 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplP PE=3 SV=1 64 194 4.0E-09
sp|A6LPR8|RL16_CLOB8 50S ribosomal protein L16 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplP PE=3 SV=1 64 209 4.0E-09
sp|A1QZS1|RL16_BORT9 50S ribosomal protein L16 OS=Borrelia turicatae (strain 91E135) GN=rplP PE=3 SV=1 64 204 4.0E-09
sp|B9KEE7|RL16_CAMLR 50S ribosomal protein L16 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplP PE=3 SV=1 64 199 4.0E-09
sp|C0ZII7|RL16_BREBN 50S ribosomal protein L16 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplP PE=3 SV=1 64 205 4.0E-09
sp|B1WQR7|RL16_CYAA5 50S ribosomal protein L16 OS=Cyanothece sp. (strain ATCC 51142) GN=rplP PE=3 SV=1 64 199 4.0E-09
sp|B9L6M6|RL16_NAUPA 50S ribosomal protein L16 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplP PE=3 SV=1 64 194 4.0E-09
sp|Q98PY9|RL16_MYCPU 50S ribosomal protein L16 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplP PE=3 SV=1 64 197 5.0E-09
sp|Q2S3Q7|RL16_SALRD 50S ribosomal protein L16 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplP PE=3 SV=1 64 199 5.0E-09
sp|Q8ETX6|RL16_OCEIH 50S ribosomal protein L16 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplP PE=3 SV=1 68 202 5.0E-09
sp|A8G1E1|RL16_SHESH 50S ribosomal protein L16 OS=Shewanella sediminis (strain HAW-EB3) GN=rplP PE=3 SV=1 64 202 6.0E-09
sp|Q7NEF9|RL16_GLOVI 50S ribosomal protein L16 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplP PE=3 SV=1 64 204 6.0E-09
sp|P51307|RK16_PORPU 50S ribosomal protein L16, chloroplastic OS=Porphyra purpurea GN=rpl16 PE=3 SV=1 64 199 6.0E-09
sp|Q8DMM5|RL16_THEEB 50S ribosomal protein L16 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplP PE=3 SV=1 64 194 6.0E-09
sp|B0JHZ6|RL16_MICAN 50S ribosomal protein L16 OS=Microcystis aeruginosa (strain NIES-843) GN=rplP PE=3 SV=1 64 194 6.0E-09
sp|Q1XDI1|RK16_PYRYE 50S ribosomal protein L16, chloroplastic OS=Pyropia yezoensis GN=rpl16 PE=3 SV=1 64 199 7.0E-09
sp|B0C1E0|RL16_ACAM1 50S ribosomal protein L16 OS=Acaryochloris marina (strain MBIC 11017) GN=rplP PE=3 SV=1 64 199 7.0E-09
sp|B3EUL6|RL16_AMOA5 50S ribosomal protein L16 OS=Amoebophilus asiaticus (strain 5a2) GN=rplP PE=3 SV=1 64 199 7.0E-09
sp|Q5UP47|RFCS3_MIMIV Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 224 412 7.0E-09
sp|Q8R7W1|RL16_CALS4 50S ribosomal protein L16 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplP PE=3 SV=1 64 202 7.0E-09
sp|A5D5G2|RL16_PELTS 50S ribosomal protein L16 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplP PE=3 SV=1 64 204 7.0E-09
sp|B1KMX6|RL16_SHEWM 50S ribosomal protein L16 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplP PE=3 SV=1 64 202 7.0E-09
sp|A9B419|RL16_HERA2 50S ribosomal protein L16 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplP PE=3 SV=1 78 207 9.0E-09
sp|C0R302|RL16_WOLWR 50S ribosomal protein L16 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rplP PE=3 SV=1 82 199 9.0E-09
sp|Q73H93|RL16_WOLPM 50S ribosomal protein L16 OS=Wolbachia pipientis wMel GN=rplP PE=3 SV=1 82 199 9.0E-09
sp|B5RM43|RL16_BORDL 50S ribosomal protein L16 OS=Borrelia duttonii (strain Ly) GN=rplP PE=3 SV=1 64 204 9.0E-09
sp|B4SBV4|RL16_PELPB 50S ribosomal protein L16 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplP PE=3 SV=1 64 194 1.0E-08
sp|A1BJ27|RL16_CHLPD 50S ribosomal protein L16 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplP PE=3 SV=1 64 204 1.0E-08
sp|B9DM40|RL16_STACT 50S ribosomal protein L16 OS=Staphylococcus carnosus (strain TM300) GN=rplP PE=3 SV=1 68 202 1.0E-08
sp|Q2JV88|RL16_SYNJA 50S ribosomal protein L16 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplP PE=3 SV=1 64 204 1.0E-08
sp|O46901|RK16_GUITH 50S ribosomal protein L16, chloroplastic OS=Guillardia theta GN=rpl16 PE=3 SV=1 64 199 1.0E-08
sp|Q3A6P0|RL16_PELCD 50S ribosomal protein L16 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplP PE=3 SV=1 64 194 1.0E-08
sp|B1XJT2|RL16_SYNP2 50S ribosomal protein L16 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplP PE=3 SV=1 64 204 1.0E-08
sp|B8CNE0|RL16_SHEPW 50S ribosomal protein L16 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplP PE=3 SV=1 64 202 1.0E-08
sp|B8D842|RL16_BUCAT 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplP PE=3 SV=1 64 180 1.0E-08
sp|P57584|RL16_BUCAI 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplP PE=3 SV=1 64 180 1.0E-08
sp|B8D9U0|RL16_BUCA5 50S ribosomal protein L16 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplP PE=3 SV=1 64 180 1.0E-08
sp|Q5HS97|RL16_CAMJR 50S ribosomal protein L16 OS=Campylobacter jejuni (strain RM1221) GN=rplP PE=3 SV=1 64 199 1.0E-08
sp|A1W1V3|RL16_CAMJJ 50S ribosomal protein L16 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplP PE=3 SV=1 64 199 1.0E-08
sp|Q9PLX8|RL16_CAMJE 50S ribosomal protein L16 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplP PE=3 SV=1 64 199 1.0E-08
sp|A7H649|RL16_CAMJD 50S ribosomal protein L16 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rplP PE=3 SV=1 64 199 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:0043043 peptide biosynthetic process No
GO:0043229 intracellular organelle No
GO:0030554 adenyl nucleotide binding No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005198 structural molecule activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0043603 cellular amide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0009059 macromolecule biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0032553 ribonucleotide binding No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2879
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4354
Ophiocordyceps australis map64 (Brazil) OphauB2|3268
Ophiocordyceps camponoti-floridani Ophcf2|06652
Ophiocordyceps camponoti-rufipedis Ophun1|5111 (this protein)
Ophiocordyceps kimflemingae Ophio5|5300
Ophiocordyceps subramaniannii Hirsu2|4779

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5111
MQIPSSNRLIPLSRALQGLRISPLASLHHRQLPAAVTTKALGNGLRLQDARQFSTSRVALGSWLEPHKDRRQKMA
KGRPRVRTGGSTKGTTVVWGDYGLRMVDHHRRISAKILKTAADTITARLRGEKFRLYKRKCANVGVYTSGNEVRM
GKGKGSFDHWATRMSVNQILFEIKGRLHEQVVRDAFRLAGNKLPGQWEFAKKGDAPVVGITKLDRVTLEELRRPR
RKLPPVELPKSSDLPLVIEEVAASVTAQSGDFPHLLVYGPSGAGKKTRVVATLKELYGPGVEKIKIDARVFQTTS
NRKLEFNIVASIYHLEITPSDVGNYDRVVVQDLLKEVAQTQQVDQSAKQRFKVVVINEADHLSRDAQAALRRTME
KYSPNLRLILLANSTSNIIAPIRSRTLLVRVAAPSHEEICDALAESAAKENWPVVAGLHRRIAVQSGRNLRRALL
IDQVTESTSIPPADWEALIGQIAKDMMAERTPAQILHVRPKLYDLLTHCIPATTILKTLTFKLLSTIDDELKGEV
IGWSAFYEHRIKTGTKVIFHLEAFVAKFMRVQEMYLMSMGM*
Coding >Ophun1|5111
ATGCAGATTCCCAGCAGCAATCGATTGATTCCGCTGAGTCGTGCGCTTCAGGGTCTTCGGATATCTCCCTTGGCG
TCTCTGCATCATCGCCAGTTGCCAGCGGCCGTCACCACGAAAGCTCTCGGCAACGGACTACGATTGCAGGATGCG
CGGCAATTCTCTACCTCACGGGTCGCGCTCGGCTCTTGGTTGGAGCCTCACAAGGACCGCCGGCAGAAAATGGCC
AAGGGCAGGCCTAGGGTGCGCACCGGTGGCTCTACCAAGGGGACGACGGTGGTCTGGGGAGACTACGGCCTGAGA
ATGGTGGACCACCATCGGAGAATCAGCGCAAAGATTCTGAAGACGGCCGCAGATACCATCACCGCGCGGCTTCGA
GGAGAGAAGTTTAGGCTATACAAGCGAAAATGTGCCAATGTCGGCGTCTACACGAGTGGGAACGAGGTGCGAATG
GGCAAGGGCAAAGGCTCTTTCGATCATTGGGCGACGAGGATGTCGGTGAATCAGATTCTGTTTGAGATAAAGGGA
CGTCTGCATGAGCAGGTCGTGAGGGACGCTTTTCGTCTAGCTGGGAACAAGCTGCCAGGCCAGTGGGAGTTTGCG
AAGAAGGGTGATGCTCCAGTGGTGGGCATCACGAAGCTGGACCGCGTTACGTTGGAGGAGCTGAGAAGACCGCGG
AGGAAGTTACCGCCTGTTGAGTTGCCAAAGTCTTCGGATCTCCCTCTTGTTATTGAGGAGGTGGCGGCGTCTGTA
ACCGCGCAAAGCGGCGACTTTCCTCATCTACTGGTGTACGGCCCATCCGGGGCTGGGAAGAAGACGAGGGTCGTG
GCAACGCTCAAAGAGCTGTACGGCCCCGGCGTGGAGAAGATCAAGATCGATGCGAGGGTCTTCCAGACGACGAGC
AACCGCAAACTCGAATTCAACATTGTGGCGTCCATCTACCATCTCGAGATTACACCGTCGGACGTGGGCAACTAC
GACCGGGTGGTGGTACAAGACTTGCTGAAAGAGGTGGCCCAGACGCAGCAGGTGGACCAGTCTGCCAAGCAGCGC
TTCAAGGTGGTGGTGATAAACGAGGCGGATCACCTTAGCCGAGACGCGCAGGCGGCGTTGCGTCGAACGATGGAG
AAGTACTCGCCCAACCTGCGGCTGATACTTCTGGCCAACTCGACGTCCAACATCATCGCGCCCATCCGGTCGAGG
ACGCTGCTGGTCAGGGTCGCGGCGCCGAGCCACGAGGAGATATGCGACGCACTGGCGGAATCGGCGGCCAAGGAG
AACTGGCCGGTCGTGGCCGGCTTGCACAGGAGGATCGCGGTGCAGAGCGGGAGAAATCTGCGGAGAGCGCTCCTG
ATTGACCAGGTGACGGAGAGCACGTCGATCCCGCCCGCCGACTGGGAGGCGCTGATTGGGCAGATCGCCAAGGAC
ATGATGGCCGAACGCACGCCGGCTCAGATCCTGCATGTGCGGCCGAAGCTGTACGATCTGCTGACACACTGTATC
CCGGCGACGACGATTCTCAAGACGTTGACGTTTAAGCTGTTGAGCACAATCGACGACGAGCTCAAGGGCGAGGTG
ATTGGATGGTCAGCCTTTTACGAGCACAGGATCAAGACGGGGACCAAGGTGATATTCCACCTGGAGGCGTTTGTG
GCCAAGTTTATGCGGGTGCAGGAGATGTACCTGATGAGCATGGGGATGTAA
Transcript >Ophun1|5111
ATGCAGATTCCCAGCAGCAATCGATTGATTCCGCTGAGTCGTGCGCTTCAGGGTCTTCGGATATCTCCCTTGGCG
TCTCTGCATCATCGCCAGTTGCCAGCGGCCGTCACCACGAAAGCTCTCGGCAACGGACTACGATTGCAGGATGCG
CGGCAATTCTCTACCTCACGGGTCGCGCTCGGCTCTTGGTTGGAGCCTCACAAGGACCGCCGGCAGAAAATGGCC
AAGGGCAGGCCTAGGGTGCGCACCGGTGGCTCTACCAAGGGGACGACGGTGGTCTGGGGAGACTACGGCCTGAGA
ATGGTGGACCACCATCGGAGAATCAGCGCAAAGATTCTGAAGACGGCCGCAGATACCATCACCGCGCGGCTTCGA
GGAGAGAAGTTTAGGCTATACAAGCGAAAATGTGCCAATGTCGGCGTCTACACGAGTGGGAACGAGGTGCGAATG
GGCAAGGGCAAAGGCTCTTTCGATCATTGGGCGACGAGGATGTCGGTGAATCAGATTCTGTTTGAGATAAAGGGA
CGTCTGCATGAGCAGGTCGTGAGGGACGCTTTTCGTCTAGCTGGGAACAAGCTGCCAGGCCAGTGGGAGTTTGCG
AAGAAGGGTGATGCTCCAGTGGTGGGCATCACGAAGCTGGACCGCGTTACGTTGGAGGAGCTGAGAAGACCGCGG
AGGAAGTTACCGCCTGTTGAGTTGCCAAAGTCTTCGGATCTCCCTCTTGTTATTGAGGAGGTGGCGGCGTCTGTA
ACCGCGCAAAGCGGCGACTTTCCTCATCTACTGGTGTACGGCCCATCCGGGGCTGGGAAGAAGACGAGGGTCGTG
GCAACGCTCAAAGAGCTGTACGGCCCCGGCGTGGAGAAGATCAAGATCGATGCGAGGGTCTTCCAGACGACGAGC
AACCGCAAACTCGAATTCAACATTGTGGCGTCCATCTACCATCTCGAGATTACACCGTCGGACGTGGGCAACTAC
GACCGGGTGGTGGTACAAGACTTGCTGAAAGAGGTGGCCCAGACGCAGCAGGTGGACCAGTCTGCCAAGCAGCGC
TTCAAGGTGGTGGTGATAAACGAGGCGGATCACCTTAGCCGAGACGCGCAGGCGGCGTTGCGTCGAACGATGGAG
AAGTACTCGCCCAACCTGCGGCTGATACTTCTGGCCAACTCGACGTCCAACATCATCGCGCCCATCCGGTCGAGG
ACGCTGCTGGTCAGGGTCGCGGCGCCGAGCCACGAGGAGATATGCGACGCACTGGCGGAATCGGCGGCCAAGGAG
AACTGGCCGGTCGTGGCCGGCTTGCACAGGAGGATCGCGGTGCAGAGCGGGAGAAATCTGCGGAGAGCGCTCCTG
ATTGACCAGGTGACGGAGAGCACGTCGATCCCGCCCGCCGACTGGGAGGCGCTGATTGGGCAGATCGCCAAGGAC
ATGATGGCCGAACGCACGCCGGCTCAGATCCTGCATGTGCGGCCGAAGCTGTACGATCTGCTGACACACTGTATC
CCGGCGACGACGATTCTCAAGACGTTGACGTTTAAGCTGTTGAGCACAATCGACGACGAGCTCAAGGGCGAGGTG
ATTGGATGGTCAGCCTTTTACGAGCACAGGATCAAGACGGGGACCAAGGTGATATTCCACCTGGAGGCGTTTGTG
GCCAAGTTTATGCGGGTGCAGGAGATGTACCTGATGAGCATGGGGATGTAA
Gene >Ophun1|5111
ATGCAGATTCCCAGCAGCAATCGATTGATTCCGCTGAGTCGTGCGCTTCAGGGTCTTCGGATATCTCCCTTGGCG
TCTCTGCATCATCGCCAGTTGCCAGCGGCCGTCACCACGAAAGCTCTCGGCAACGGACTACGATTGCAGGATGCG
CGGCAATTCTCTACCTCACGGGTCGCGCTCGGCTCTTGGTTGGAGCCTCACAAGGACCGCCGGCAGAAAATGGCC
AAGGGCAGGCCTAGGGTGCGCACCGGTGGCTCTACCAAGGGGACGACGGTGGTCTGGGGAGACTACGGCCTGAGA
ATGGTGGACCACCATCGGAGAATCAGCGCAAAGATTCTGAAGACGGCCGCAGATACCATCACCGCGCGGCTTCGA
GGAGAGAAGTTTAGGCTATACAAGCGAAAATGTGCCAATGTCGGCGTCTACACGAGTGGGAACGAGGTGAGGACT
CGATGCGACAGCCTTCCGGCGACGACATCAGCTTACAGGCCATTAGGTGCGAATGGGCAAGGGCAAAGGCTCTTT
CGATCATTGGGCGACGAGGATGTCGGTGAATCAGATTCTGTTTGAGATAAAGGGACGTCTGCATGAGCAGGTCGT
GAGGGACGCTTTTCGTCTAGCTGGGAACAAGCTGCCAGGTCGGTTTCCCCGAATCAGATGAATTGCTACCTGTTG
CTAACCGGGTCCAGGCCAGTGGGAGTTTGCGAAGAAGGGTGATGCTCCAGTGGTGGGCATCACGAAGCTGGACCG
CGTTACGTTGGAGGAGCTGAGAAGACCGCGGAGGAAGTTACCGCCTGTTGAGTTGCCAAAGTCTTCGGATCTCCC
TCTTGTTATTGAGGAGGTGGCGGCGTCTGTAACCGTGAGTCCACCATGACATGGCTCTGAAGGGGTTTTGTACGA
CGGGCCGACCAAGTGAACTCCTGGACCTTGTCGTGTGCATCAGGCAACGTGACTTGGCTAAAGTCCATTAAGACG
TGAATGAGATTAATTCCACGCCTGCTGCAACTCTTTACTCGATAAATCATAGGAGCCTTCTCCTGGAAAGGCCGG
TGGGACGCCTCTATTCGTACTCCGTACGAGCACGTGCACAGCGGGCCTCTCGGAAAAGGTTCATCCGGTCACCGA
CCAGCACTCAACGCGCGACGCGTCTCGCTGAAAATACTGGGACTCTCTAGAATCTCCCGCACTGGGCCTCGACTT
CATTCACGGCATCAAGATCTCGCTGAGCCATCATGGCGCTCATCGTCGACAAGCACCGACCGCGGACGCTCGAAG
CCCTTAGTTATCATCACGAATTGTCGGAGCGGCTGCAATCCCTCGTAGGGCGCATCTCGAAGCTCGTCTTGTGCT
TCACCGGCTGACATGGCACAGGCGCAAAGCGGCGACTTTCCTCATCTACTGGTGTACGGCCCATCCGGGGCTGGG
AAGAAGACGAGGGTCGTGGCAACGCTCAAAGAGCTGTACGGCCCCGGCGTGGAGAAGATCAAGATCGATGCGAGG
GTCTTCCAGACGACGAGCAACCGCAAACTCGAATTCAACATTGTGGCGTCCATCTACCATCTCGAGATTACACCG
TCGGACGTGGGCAACTACGACCGGGTGGTGGTACAAGACTTGCTGAAAGAGGTGGCCCAGACGCAGCAGGTGGAC
CAGTCTGCCAAGCAGCGCTTCAAGGTGGTGGTGATAAACGAGGCGGATCACCTTAGCCGAGACGCGCAGGCGGCG
TTGCGTCGAACGATGGAGAAGTACTCGCCCAACCTGCGGCTGATACTTCTGGCCAACTCGACGTCCAACATCATC
GCGCCCATCCGGTCGAGGACGCTGCTGGTCAGGGTCGCGGCGCCGAGCCACGAGGAGATATGCGACGCACTGGCG
GAATCGGCGGCCAAGGAGAACTGGCCGGTCGTGGCCGGCTTGCACAGGAGGATCGCGGTGCAGAGCGGGAGAAAT
CTGCGGAGAGCGCTCCTGATGTACGAGGCCGTACACGCTCAAAAGTCGGTCATGGTCCCCTCGGCTCTGTCCCCT
CAGCTCTGTGCCCTCAGCTCTGTGCCCTCAGCTCCCCTGCCCCCCGACGGTTGACGGTACTGACGCTCAGGCCCC
AGTGACCAGGTGACGGAGAGCACGTCGATCCCGCCCGCCGACTGGGAGGCGCTGATTGGGCAGATCGCCAAGGAC
ATGATGGCCGAACGCACGCCGGCTCAGATCCTGCATGTGCGGCCGAAGCTGTACGATCTGCTGACACACTGTATC
CCGGCGACGACGATTCTCAAGACGTTGACGTTTAAGCTGTTGAGCACAATCGACGACGAGCTCAAGGGCGAGGTG
ATTGGATGGTCAGCCTTTTACGAGCACAGGATCAAGACGGGGACCAAGGTGATATTCCACCTGGAGGCGTTTGTG
GCCAAGTTTATGCGGGTGCAGGAGATGTACCTGATGAGCATGGGGATGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail