Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5105
Gene name
LocationContig_491:415..3496
Strand-
Gene length (bp)3081
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 8.5E-21 137 396
PF13515 FUSC_2 Fusaric acid resistance protein-like 5.4E-08 613 734
PF10334 ArAE_2 Aromatic acid exporter family member 2 1.1E-05 738 906

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 585 959 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 78 100 22
3 104 123 19
4 143 160 17
5 165 187 22
6 199 221 22
7 589 608 19
8 620 637 17
9 641 663 22
10 668 690 22
11 717 739 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5105
MAVWPRTGKRRRAAKTAEPKPEPKSRTSTRLAQLKAVLLQLKPDVGSVFMAFKMTIAPLVCMCLIQSNVWINHFK
TNGYLVALIANLALPFLPRGTLVLFNVRLALMTGVSYCYVLLAGWCGLQARKHTTHSPEQLKAYNSSAEAVVAIW
LIFCVWLIFSLKSAYPSLFNLLSVGGIFAVATLPGLARAPTMKDVISQASNVVESFLAGQAFGFFVGIVILPRSG
RDEFRQTFKGCLDGLVGVVRAHERCMDVFKARPPDYVPPSPTSMGDDADERAAAATKLQEALKGFTQGVIKARAA
AGHAKLEMSFGRLDHGELEKMVSGLVDLVPPASGLFAVADMLKGAIDGSLQAAMASEAKRRRGTNATVDRQDEEE
GDEEEQERETLDWHQHEEAILQHLHNISEAIVSGVEHAKLRFHLTDNKLKLPFVHRTKEDSSSPESFLESFRSVL
QNECVVGQGEKLMDHYIRHRPKLEDLCIVRTEEQLDYVRYVLLLHSQTLLSSLSSEFEGLLILGEDYHREPPRLI
IPPLGHVNWRSLFRLNRRATDDSGVELGAGFRKKDPDHLPPVNAFEKVGNYVRLIPAALRSEHAAYGLRGACAIM
TIAIIGFLKSSQTFFFRQRLIWSLFAIVMSLGRTAGNSTFLLFSRTMGTIASMVASYIIWYIVDQKVAVLKFPLY
GSAVFVALFTAIIMICNDLQIKKIGAAKLESQYSIYPPYVNFPYRLAIVLLGVVVAYFWTIFPFPMSEHGQLRQE
VASSLNLLSNYYSCISQAVLSRLQGSFGDPRDEASPGFYILAARRRIFRKFQTVNTAARSNLSLVDWEFSLGGHF
PKHNYTEILSLLDRIASYMSLTGYASRAFQGMSDTSAWCFVDEDDVTRSNLLIEGVTTRMVVLHSALSRAHPLPP
QLQELTRAQMPEFSRETRSEGLAAAALIHGVNSYIVRDINRLTQLVKDLVSELDFTVTIETDSEIPLTPARNSRP
ST*
Coding >Ophun1|5105
ATGGCCGTCTGGCCGAGGACCGGCAAGCGACGCCGCGCCGCAAAGACGGCCGAGCCGAAGCCGGAGCCCAAGTCC
CGGACCTCGACTCGTCTCGCGCAGCTCAAGGCGGTGCTGCTTCAGCTCAAGCCCGACGTCGGCAGCGTCTTCATG
GCCTTTAAGATGACCATTGCCCCCCTCGTCTGCATGTGCCTCATCCAAAGCAACGTCTGGATCAACCACTTCAAG
ACGAATGGCTACCTGGTCGCTCTCATAGCTAACCTGGCCCTGCCTTTCCTTCCGCGAGGCACCCTCGTCCTCTTC
AACGTTCGGCTGGCTCTTATGACTGGAGTATCTTACTGCTACGTTCTACTCGCCGGCTGGTGTGGACTCCAGGCG
CGCAAGCACACGACGCATAGCCCCGAGCAGCTCAAAGCCTACAACTCGTCTGCTGAGGCTGTAGTCGCCATCTGG
CTCATCTTCTGCGTTTGGTTAATCTTCAGTCTCAAGTCGGCGTATCCTTCCCTCTTCAACCTGCTCTCTGTTGGA
GGTATATTCGCCGTGGCCACACTGCCAGGCCTCGCGCGCGCCCCGACGATGAAAGACGTCATCTCCCAAGCCAGC
AACGTCGTCGAGAGCTTCCTCGCCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATTCTGCCCAGAAGCGGA
AGGGATGAGTTCCGACAAACCTTCAAGGGCTGTCTCGATGGCCTCGTCGGTGTCGTTCGCGCTCATGAGAGATGT
ATGGATGTCTTCAAGGCCAGACCGCCAGACTATGTGCCTCCGTCACCGACGTCAATGGGAGATGACGCCGATGAG
AGGGCCGCGGCGGCGACGAAGCTGCAGGAGGCCCTCAAAGGCTTCACCCAGGGCGTCATCAAGGCGCGCGCCGCG
GCTGGCCATGCCAAGCTCGAGATGTCCTTTGGCAGGCTGGATCACGGCGAGCTCGAGAAAATGGTGTCTGGGCTC
GTTGATCTCGTGCCTCCGGCTTCGGGCTTGTTTGCCGTGGCTGACATGCTCAAGGGGGCGATTGACGGCTCTCTG
CAGGCCGCCATGGCTAGCGAAGCCAAGAGACGGCGAGGAACAAACGCCACAGTCGATAGACAGGACGAGGAGGAA
GGTGACGAGGAAGAACAAGAGAGAGAAACGCTGGACTGGCATCAACACGAAGAAGCCATCCTCCAGCATCTGCAC
AACATCTCCGAGGCCATAGTCAGTGGTGTAGAGCACGCCAAGTTGCGCTTCCACTTGACCGACAACAAGCTCAAG
CTTCCTTTCGTTCACAGAACCAAGGAAGACAGCTCTAGTCCCGAGAGCTTTCTCGAATCGTTTCGCAGCGTCCTC
CAGAACGAGTGCGTCGTCGGCCAGGGTGAGAAGCTGATGGATCATTACATTCGTCATCGCCCTAAGCTCGAGGAC
CTATGTATTGTCAGGACGGAAGAGCAGCTCGACTACGTCAGATACGTCCTCCTCCTACATTCTCAAACCCTCCTA
TCTTCCCTCTCGAGCGAATTCGAGGGCCTTCTCATTCTCGGCGAAGACTACCATAGAGAGCCCCCGCGTCTCATC
ATCCCCCCCCTGGGCCACGTCAACTGGCGCAGTCTGTTTCGCCTCAACCGCAGGGCCACCGATGACTCCGGCGTC
GAGCTCGGCGCTGGCTTCCGCAAGAAGGACCCGGATCACTTACCGCCAGTCAATGCATTCGAGAAGGTCGGCAAC
TACGTCCGGTTGATACCCGCAGCCTTACGATCCGAACACGCAGCATACGGACTTCGAGGAGCATGTGCCATCATG
ACGATTGCCATCATTGGATTCCTCAAGTCCTCTCAAACCTTCTTCTTCAGACAGCGGCTGATATGGTCACTATTC
GCCATTGTCATGTCTCTGGGTCGGACCGCAGGCAACTCGACTTTTCTGCTGTTTAGCCGCACAATGGGAACCATA
GCTTCCATGGTCGCTAGCTACATCATCTGGTATATCGTCGATCAGAAAGTTGCTGTCTTGAAGTTCCCTCTCTAC
GGCAGCGCCGTCTTCGTTGCCCTGTTCACGGCCATCATCATGATTTGCAACGATTTACAGATCAAGAAGATTGGC
GCCGCAAAGCTGGAGTCACAGTACTCTATCTATCCGCCGTATGTCAACTTTCCATACAGGCTGGCCATTGTCTTG
TTAGGTGTCGTCGTCGCCTACTTCTGGACCATCTTTCCTTTCCCCATGTCCGAACATGGTCAGCTCCGTCAGGAG
GTTGCGAGTTCCTTGAACCTGCTGAGCAACTACTATTCCTGTATCAGCCAGGCCGTTCTGTCGCGTTTACAGGGC
AGCTTTGGCGATCCACGGGACGAGGCCAGCCCCGGCTTTTACATCCTTGCCGCTCGCCGCCGTATTTTCCGCAAG
TTCCAGACCGTCAACACCGCTGCTCGGTCAAATCTTTCGCTCGTTGACTGGGAGTTCTCTCTCGGTGGCCACTTT
CCAAAGCACAACTACACCGAGATTCTGTCTCTTCTCGACCGCATAGCGAGCTACATGTCACTCACAGGCTACGCT
TCCCGGGCCTTCCAAGGCATGTCAGACACGTCGGCCTGGTGCTTTGTCGACGAAGACGACGTCACACGATCCAAC
TTGCTGATTGAGGGCGTCACCACCCGCATGGTCGTCCTTCACTCGGCCCTGAGCCGGGCACATCCCCTGCCCCCC
CAACTTCAGGAGCTGACCCGAGCCCAAATGCCCGAGTTCTCTAGGGAAACCAGAAGCGAAGGCTTGGCGGCTGCA
GCCCTCATTCATGGCGTCAACTCGTATATAGTCCGTGATATAAATCGTCTCACGCAGCTGGTCAAGGATCTTGTC
TCAGAGCTGGATTTTACCGTCACCATCGAGACAGACAGCGAGATTCCGCTCACCCCGGCTAGAAATTCTCGGCCG
TCGACATGA
Transcript >Ophun1|5105
ATGGCCGTCTGGCCGAGGACCGGCAAGCGACGCCGCGCCGCAAAGACGGCCGAGCCGAAGCCGGAGCCCAAGTCC
CGGACCTCGACTCGTCTCGCGCAGCTCAAGGCGGTGCTGCTTCAGCTCAAGCCCGACGTCGGCAGCGTCTTCATG
GCCTTTAAGATGACCATTGCCCCCCTCGTCTGCATGTGCCTCATCCAAAGCAACGTCTGGATCAACCACTTCAAG
ACGAATGGCTACCTGGTCGCTCTCATAGCTAACCTGGCCCTGCCTTTCCTTCCGCGAGGCACCCTCGTCCTCTTC
AACGTTCGGCTGGCTCTTATGACTGGAGTATCTTACTGCTACGTTCTACTCGCCGGCTGGTGTGGACTCCAGGCG
CGCAAGCACACGACGCATAGCCCCGAGCAGCTCAAAGCCTACAACTCGTCTGCTGAGGCTGTAGTCGCCATCTGG
CTCATCTTCTGCGTTTGGTTAATCTTCAGTCTCAAGTCGGCGTATCCTTCCCTCTTCAACCTGCTCTCTGTTGGA
GGTATATTCGCCGTGGCCACACTGCCAGGCCTCGCGCGCGCCCCGACGATGAAAGACGTCATCTCCCAAGCCAGC
AACGTCGTCGAGAGCTTCCTCGCCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATTCTGCCCAGAAGCGGA
AGGGATGAGTTCCGACAAACCTTCAAGGGCTGTCTCGATGGCCTCGTCGGTGTCGTTCGCGCTCATGAGAGATGT
ATGGATGTCTTCAAGGCCAGACCGCCAGACTATGTGCCTCCGTCACCGACGTCAATGGGAGATGACGCCGATGAG
AGGGCCGCGGCGGCGACGAAGCTGCAGGAGGCCCTCAAAGGCTTCACCCAGGGCGTCATCAAGGCGCGCGCCGCG
GCTGGCCATGCCAAGCTCGAGATGTCCTTTGGCAGGCTGGATCACGGCGAGCTCGAGAAAATGGTGTCTGGGCTC
GTTGATCTCGTGCCTCCGGCTTCGGGCTTGTTTGCCGTGGCTGACATGCTCAAGGGGGCGATTGACGGCTCTCTG
CAGGCCGCCATGGCTAGCGAAGCCAAGAGACGGCGAGGAACAAACGCCACAGTCGATAGACAGGACGAGGAGGAA
GGTGACGAGGAAGAACAAGAGAGAGAAACGCTGGACTGGCATCAACACGAAGAAGCCATCCTCCAGCATCTGCAC
AACATCTCCGAGGCCATAGTCAGTGGTGTAGAGCACGCCAAGTTGCGCTTCCACTTGACCGACAACAAGCTCAAG
CTTCCTTTCGTTCACAGAACCAAGGAAGACAGCTCTAGTCCCGAGAGCTTTCTCGAATCGTTTCGCAGCGTCCTC
CAGAACGAGTGCGTCGTCGGCCAGGGTGAGAAGCTGATGGATCATTACATTCGTCATCGCCCTAAGCTCGAGGAC
CTATGTATTGTCAGGACGGAAGAGCAGCTCGACTACGTCAGATACGTCCTCCTCCTACATTCTCAAACCCTCCTA
TCTTCCCTCTCGAGCGAATTCGAGGGCCTTCTCATTCTCGGCGAAGACTACCATAGAGAGCCCCCGCGTCTCATC
ATCCCCCCCCTGGGCCACGTCAACTGGCGCAGTCTGTTTCGCCTCAACCGCAGGGCCACCGATGACTCCGGCGTC
GAGCTCGGCGCTGGCTTCCGCAAGAAGGACCCGGATCACTTACCGCCAGTCAATGCATTCGAGAAGGTCGGCAAC
TACGTCCGGTTGATACCCGCAGCCTTACGATCCGAACACGCAGCATACGGACTTCGAGGAGCATGTGCCATCATG
ACGATTGCCATCATTGGATTCCTCAAGTCCTCTCAAACCTTCTTCTTCAGACAGCGGCTGATATGGTCACTATTC
GCCATTGTCATGTCTCTGGGTCGGACCGCAGGCAACTCGACTTTTCTGCTGTTTAGCCGCACAATGGGAACCATA
GCTTCCATGGTCGCTAGCTACATCATCTGGTATATCGTCGATCAGAAAGTTGCTGTCTTGAAGTTCCCTCTCTAC
GGCAGCGCCGTCTTCGTTGCCCTGTTCACGGCCATCATCATGATTTGCAACGATTTACAGATCAAGAAGATTGGC
GCCGCAAAGCTGGAGTCACAGTACTCTATCTATCCGCCGTATGTCAACTTTCCATACAGGCTGGCCATTGTCTTG
TTAGGTGTCGTCGTCGCCTACTTCTGGACCATCTTTCCTTTCCCCATGTCCGAACATGGTCAGCTCCGTCAGGAG
GTTGCGAGTTCCTTGAACCTGCTGAGCAACTACTATTCCTGTATCAGCCAGGCCGTTCTGTCGCGTTTACAGGGC
AGCTTTGGCGATCCACGGGACGAGGCCAGCCCCGGCTTTTACATCCTTGCCGCTCGCCGCCGTATTTTCCGCAAG
TTCCAGACCGTCAACACCGCTGCTCGGTCAAATCTTTCGCTCGTTGACTGGGAGTTCTCTCTCGGTGGCCACTTT
CCAAAGCACAACTACACCGAGATTCTGTCTCTTCTCGACCGCATAGCGAGCTACATGTCACTCACAGGCTACGCT
TCCCGGGCCTTCCAAGGCATGTCAGACACGTCGGCCTGGTGCTTTGTCGACGAAGACGACGTCACACGATCCAAC
TTGCTGATTGAGGGCGTCACCACCCGCATGGTCGTCCTTCACTCGGCCCTGAGCCGGGCACATCCCCTGCCCCCC
CAACTTCAGGAGCTGACCCGAGCCCAAATGCCCGAGTTCTCTAGGGAAACCAGAAGCGAAGGCTTGGCGGCTGCA
GCCCTCATTCATGGCGTCAACTCGTATATAGTCCGTGATATAAATCGTCTCACGCAGCTGGTCAAGGATCTTGTC
TCAGAGCTGGATTTTACCGTCACCATCGAGACAGACAGCGAGATTCCGCTCACCCCGGCTAGAAATTCTCGGCCG
TCGACATGA
Gene >Ophun1|5105
ATGGCCGTCTGGCCGAGGACCGGCAAGCGACGCCGCGCCGCAAAGACGGCCGAGCCGAAGCCGGAGCCCAAGTCC
CGGACCTCGACTCGTCTCGCGCAGCTCAAGGCGGTGCTGCTTCAGCTCAAGCCCGACGTCGGCAGCGTCTTCATG
GCCTTTAAGATGACCATTGCCCCCCTCGTCTGCATGTGCCTCATCCAAAGCAACGTCTGGATCAACCACTTCAAG
ACGAATGGCTACCTGGTCGCTCTCATAGCTAACCTGGCCCTGCCTTTCCTTCCGCGAGGCACCCTCGTCCTCTTC
AACGTTCGGCTGGCTCTTATGACTGGAGTATCTTACTGCTACGTTCTACTCGCCGGCTGGTGTGGACTCCAGGCG
CGCAAGCACACGACGCATAGCCCCGAGCAGCTCAAAGCCTACAACTCGTCTGCTGAGGCTGTAGTCGCCATCTGG
CTCATCTTCTGCGTTTGGTTAATCTTCAGTCTCAAGTCGGCGTATCCTTCCCTCTTCAACCTGCTCTCTGTTGGA
GGTATATTCGCCGTGGCCACACTGCCAGGCCTCGCGCGCGCCCCGACGATGAAAGACGTCATCTCCCAAGCCAGC
AACGTCGTCGAGAGCTTCCTCGCCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATTCTGCCCAGAAGCGGA
AGGGATGAGTTCCGACAAACCTTCAAGGGCTGTCTCGATGGCCTCGTCGGTGTCGTTCGCGCTCATGAGAGATGT
ATGGATGTCTTCAAGGCCAGACCGCCAGACTATGTGCCTCCGTCACCGACGTCAATGGGAGATGACGCCGATGAG
AGGGCCGCGGCGGCGACGAAGCTGCAGGAGGCCCTCAAAGGCTTCACCCAGGGCGTCATCAAGGCGCGCGCCGCG
GCTGGCCATGCCAAGCTCGAGATGTCCTTTGGCAGGCTGGATCACGGCGAGCTCGAGAAAATGGTGTCTGGGCTC
GTTGATCTCGTGCCTCCGGCTTCGGGCTTGTTTGCCGTGGCTGACATGCTCAAGGGGGCGATTGACGGCTCTCTG
CAGGCCGCCATGGCTAGCGAAGCCAAGAGACGGCGAGGAACAAACGCCACAGTCGATAGACAGGACGAGGAGGAA
GGTGACGAGGAAGAACAAGAGAGAGAAACGCTGGACTGGCATCAACACGAAGAAGCCATCCTCCAGCATCTGCAC
AACATCTCCGAGGCCATAGTCAGTGGTGTAGAGCACGCCAAGTTGCGCTTCCACTTGACCGACAACAAGCTCAAG
CTTCCTTTCGTTCACAGAACCAAGGAAGACAGCTCTAGTCCCGAGAGCTTTCTCGAATCGTTTCGCAGCGTCCTC
CAGAACGAGTGCGTCGTCGGCCAGGGTGAGAAGCTGATGGATCATTACATTCGTCATCGCCCTAAGCTCGAGGAC
CTATGTATTGTCAGGACGGAAGAGCAGCTCGACTACGTCAGATACGTCCTCCTCCTACATGTACGAAGTCTTCCA
TCTATCCCGGTATCCCGCATCTGACAGGCTACAAGTCTCAAACCCTCCTATCTTCCCTCTCGAGCGAATTCGAGG
GCCTTCTCATTCTCGGCGAAGACTACCATAGAGAGCCCCCGCGTCTCATCATCCCCCCCCTGGGCCACGTCAACT
GGCGCAGTCTGTTTCGCCTCAACCGCAGGGCCACCGATGACTCCGGCGTCGAGCTCGGCGCTGGCTTCCGCAAGA
AGGACCCGGATCACTTACCGCCAGTCAATGCATTCGAGAAGGTCGGCAACTACGTCCGGTTGATACCCGCAGCCT
TACGATCCGAACACGCAGCATACGGACTTCGAGGAGCATGTGCCATCATGACGATTGCCATCATTGGATTCCTCA
AGTCCTCTCAAACCTTCTTCTTCAGACAGCGGCTGATATGGTCACTATTCGCCATTGTCATGTCTCTGGGTCGGA
CCGCAGGCAACTCGACTTTTCTGCTGTTTAGCCGCACAATGGGAACCATAGCTTCCATGGTCGCTAGCTACATCA
TCTGGTATATCGTCGATCAGAAAGTTGCTGGTATCTATGTTTTCCTAGAGCTGTGGCTATTTTGCCTCTGCTACT
TGCGTACGCATCTCCCCCTTCACATATCGAGTCTTCACTAACATTCATTAAGTCTTGAAGTTCCCTCTCTACGGC
AGCGCCGTCTTCGTTGCCCTGTTCACGGCCATCATCATGATTTGCAACGATTTACAGATCAAGAAGATTGGCGCC
GCAAAGCTGGAGTCACAGTACTCTATCTATCCGCCGTATGTCAACTTTCCATACAGGCTGGCCATTGTCTTGTTA
GGTGTCGTCGTCGCCTACTTCTGGACCATCTTTCCTTTCCCCATGTCCGAACATGGTCAGCTCCGTCAGGAGGTT
GCGAGTTCCTTGAACCTGCTGAGCAACTACTATTCCTGTATCAGCCAGGCCGTTCTGTCGCGTTTACAGGGCAGC
TTTGGCGATCCACGGGACGAGGCCAGCCCCGGCTTTTACATCCTTGCCGCTCGCCGCCGTATTTTCCGCAAGTTC
CAGACCGTCAACACCGCTGCTCGGTCAAATCTTTCGCTCGTTGACTGGGAGTTCTCTCTCGGTGGCCACTTTCCA
AAGCACAACTACACCGAGATTCTGTCTCTTCTCGACCGCATAGCGAGCTACATGTCACTCACAGGCTACGCTTCC
CGGGCCTTCCAAGGCATGTCAGACACGTCGGCCTGGTGCTTTGTCGACGAAGACGACGTCACACGATCCAACTTG
CTGATTGAGGGCGTCACCACCCGCATGGTCGTCCTTCACTCGGCCCTGAGCCGGGCACATCCCCTGCCCCCCCAA
CTTCAGGAGCTGACCCGAGCCCAAATGCCCGAGTTCTCTAGGGAAACCAGAAGCGAAGGCTTGGCGGCTGCAGCC
CTCATTCATGGCGTCAACTCGTATATAGTCCGTGATATAAATCGTCTCACGCAGCTGGTCAAGGATCTTGTCTCA
GAGCTGGATTTTACCGTCACCATCGAGACAGACAGCGAGATTCCGCTCACCCCGGCTAGAAATTCTCGGCCGTCG
ACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail