Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5101
Gene name
LocationContig_490:2406..3651
Strand+
Gene length (bp)1245
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04003 Utp12 Dip2/Utp12 Family 1.6E-22 165 266

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HE11|UTP5_SCHPO U3 small nucleolar RNA-associated protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp5 PE=3 SV=2 152 302 1.0E-24
sp|Q04177|UTP5_YEAST U3 small nucleolar RNA-associated protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP5 PE=1 SV=1 156 264 2.0E-19
sp|Q9Y7N1|YCK3_SCHPO Uncharacterized protein C1450.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.03 PE=1 SV=1 163 275 6.0E-11
sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens GN=WDR43 PE=1 SV=3 152 282 5.0E-10
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 152 339 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2032
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3747
Ophiocordyceps australis map64 (Brazil) OphauB2|3820
Ophiocordyceps camponoti-floridani Ophcf2|05141
Ophiocordyceps camponoti-rufipedis Ophun1|5101 (this protein)
Ophiocordyceps kimflemingae Ophio5|6127
Ophiocordyceps subramaniannii Hirsu2|2300

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5101
MSAKRKAPVKLAAPVAKTPASTRTHTTIDESKTSVSGTTNAPRSSQAEAIVISSDEENDDDDDEDQDENDEAAEA
EQASADAPQPEAAQLQTTAQQVNGNPPAGEESEAEPPSFGDLLRGSETIDVASFAQQTDTAVTRHPPAAVVPPSH
KSLITVLSQALRSDDNDLLESCLRTKDTVTIQNTIERIDSPLAGMLLTKLAARMHRRPGRAGDLMNWVLWVLVAH
GGALASQPQVLQGLSSLQKVLADRTKGLNSLLALSGKLDLLEGQMDLRQRMQRGASSIRLVDDDGDDDEEDVIWV
EGETAGASGGTRRIRNEDVAVAANGIVFGLDDDDSHDSDSDGSQADDMAAEDFVLDEAVEDDLANDIWDADQEGQ
TNYEDEDDKNKHGQDSDAEAAAPPSKAPKVSKSSRPRKS*
Coding >Ophun1|5101
ATGTCGGCAAAGCGGAAAGCGCCGGTCAAGCTGGCGGCGCCCGTCGCCAAGACGCCCGCGTCAACTCGCACACAT
ACGACCATTGACGAGTCCAAGACGTCCGTCTCTGGGACCACCAATGCCCCGCGGAGCTCTCAGGCAGAGGCGATA
GTCATCTCGTCCGACGAAGAGAACGACGATGATGACGATGAGGATCAAGATGAAAACGACGAGGCGGCCGAGGCG
GAGCAAGCGAGCGCTGACGCTCCCCAACCCGAAGCTGCTCAACTCCAAACGACGGCTCAACAAGTCAATGGCAAT
CCGCCCGCCGGTGAAGAATCAGAAGCTGAACCGCCTTCCTTTGGCGATCTTCTTCGGGGCAGCGAGACCATCGAT
GTAGCATCATTTGCCCAGCAGACCGACACTGCCGTGACTCGACATCCGCCAGCCGCCGTCGTTCCCCCTTCGCAC
AAGTCCCTCATCACGGTGCTCAGCCAAGCGCTCCGGAGCGACGACAACGACCTCCTCGAGTCGTGTCTCCGGACC
AAGGATACGGTGACGATCCAGAATACGATAGAGCGCATCGACAGCCCCCTCGCCGGCATGCTCCTAACCAAGCTC
GCGGCGCGCATGCACAGACGACCGGGCCGAGCCGGCGACTTGATGAACTGGGTATTATGGGTTCTCGTCGCTCAC
GGTGGTGCTTTGGCCTCGCAGCCTCAGGTTCTCCAGGGCTTGAGTTCGCTGCAAAAGGTGCTGGCCGACCGAACC
AAAGGGCTCAACAGTCTTCTAGCCTTGTCAGGGAAACTCGATCTGCTCGAGGGTCAGATGGACCTGCGTCAGAGG
ATGCAAAGAGGCGCGAGCTCGATCCGACTCGTCGATGACGACGGTGACGACGACGAGGAAGATGTCATCTGGGTC
GAAGGCGAGACAGCCGGCGCCAGCGGCGGCACACGAAGGATACGAAATGAAGACGTCGCGGTGGCGGCCAACGGC
ATCGTCTTTGGCTTGGACGACGACGACTCACACGATTCGGACTCGGACGGCTCGCAAGCAGACGATATGGCGGCC
GAAGACTTTGTCCTCGACGAAGCGGTTGAAGACGACCTCGCCAACGACATCTGGGACGCCGATCAAGAAGGCCAG
ACCAACTACGAAGACGAAGACGACAAGAACAAGCATGGCCAAGATAGCGACGCCGAAGCCGCCGCCCCCCCATCC
AAAGCCCCCAAGGTGTCCAAATCGTCGCGCCCACGAAAAAGTTAA
Transcript >Ophun1|5101
ATGTCGGCAAAGCGGAAAGCGCCGGTCAAGCTGGCGGCGCCCGTCGCCAAGACGCCCGCGTCAACTCGCACACAT
ACGACCATTGACGAGTCCAAGACGTCCGTCTCTGGGACCACCAATGCCCCGCGGAGCTCTCAGGCAGAGGCGATA
GTCATCTCGTCCGACGAAGAGAACGACGATGATGACGATGAGGATCAAGATGAAAACGACGAGGCGGCCGAGGCG
GAGCAAGCGAGCGCTGACGCTCCCCAACCCGAAGCTGCTCAACTCCAAACGACGGCTCAACAAGTCAATGGCAAT
CCGCCCGCCGGTGAAGAATCAGAAGCTGAACCGCCTTCCTTTGGCGATCTTCTTCGGGGCAGCGAGACCATCGAT
GTAGCATCATTTGCCCAGCAGACCGACACTGCCGTGACTCGACATCCGCCAGCCGCCGTCGTTCCCCCTTCGCAC
AAGTCCCTCATCACGGTGCTCAGCCAAGCGCTCCGGAGCGACGACAACGACCTCCTCGAGTCGTGTCTCCGGACC
AAGGATACGGTGACGATCCAGAATACGATAGAGCGCATCGACAGCCCCCTCGCCGGCATGCTCCTAACCAAGCTC
GCGGCGCGCATGCACAGACGACCGGGCCGAGCCGGCGACTTGATGAACTGGGTATTATGGGTTCTCGTCGCTCAC
GGTGGTGCTTTGGCCTCGCAGCCTCAGGTTCTCCAGGGCTTGAGTTCGCTGCAAAAGGTGCTGGCCGACCGAACC
AAAGGGCTCAACAGTCTTCTAGCCTTGTCAGGGAAACTCGATCTGCTCGAGGGTCAGATGGACCTGCGTCAGAGG
ATGCAAAGAGGCGCGAGCTCGATCCGACTCGTCGATGACGACGGTGACGACGACGAGGAAGATGTCATCTGGGTC
GAAGGCGAGACAGCCGGCGCCAGCGGCGGCACACGAAGGATACGAAATGAAGACGTCGCGGTGGCGGCCAACGGC
ATCGTCTTTGGCTTGGACGACGACGACTCACACGATTCGGACTCGGACGGCTCGCAAGCAGACGATATGGCGGCC
GAAGACTTTGTCCTCGACGAAGCGGTTGAAGACGACCTCGCCAACGACATCTGGGACGCCGATCAAGAAGGCCAG
ACCAACTACGAAGACGAAGACGACAAGAACAAGCATGGCCAAGATAGCGACGCCGAAGCCGCCGCCCCCCCATCC
AAAGCCCCCAAGGTGTCCAAATCGTCGCGCCCACGAAAAAGTTAA
Gene >Ophun1|5101
ATGTCGGCAAAGCGGAAAGCGCCGGTCAAGCTGGCGGCGCCCGTCGCCAAGACGCCCGCGTCAACTCGCACACAT
ACGACCATTGACGAGTCCAAGACGTCCGTCTCTGGGACCACCAATGCCCCGCGGAGCTCTCAGGCAGAGGCGATA
GTCATCTCGTCCGACGAAGAGAACGACGATGATGACGATGAGGATCAAGATGAAAACGACGAGGCGGCCGAGGCG
GAGCAAGCGAGCGCTGACGCTCCCCAACCCGAAGCTGCTCAACTCCAAACGACGGCTCAACAAGTCAATGGCAAT
CCGCCCGCCGGTGAAGAATCAGAAGCTGAACCGCCTTCCTTTGGCGATCTTCTTCGGGGCAGCGAGACCATCGAT
GTAGCATCATTTGCCCAGCAGACCGACACTGCCGTGACTCGACATCCGCCAGCCGCCGTCGTTCCCCCTTCGCAC
AAGTCCCTCATCACGGTGCTCAGCCAAGCGCTCCGGAGCGACGACAACGACCTCCTCGAGTCGTGTCTCCGGACC
AAGGATACGGTGACGATCCAGAATACGATAGAGCGCATCGACAGCCCCCTCGCCGGCATGCTCCTAACCAAGCTC
GCGGCGCGCATGCACAGACGACCGGGCCGAGCCGGCGACTTGATGAACTGGGTATTATGGGTTCTCGTCGCTCAC
GGTGGTGCTTTGGCCTCGCAGCCTCAGGTTCTCCAGGGCTTGAGTTCGCTGCAAAAGGTGCTGGCCGACCGAACC
AAAGGGCTCAACAGTCTTCTAGCCTTGTCAGGGAAACTCGATCTGCTCGAGGGTCAGATGGACCTGCGTCAGAGG
ATGCAAAGAGGCGCGAGCTCGATCCGACTCGTCGATGACGACGGTGACGACGACGAGGAAGATGTCATCTGGGTC
GAAGGCGAGACAGCCGGCGCCAGCGGCGGCACACGAAGGATACGAAATGAAGACGTCGCGGTGGCGGCCAACGGC
ATCGTCTTTGGCTTGGACGACGACGACTCACACGATTCGGACTCGGACGGCTCGCAAGCAGACGATATGGCGGCC
GAAGACTTTGTCCTCGACGAAGCGGTTGAAGACGACCTCGCCAACGACATCTGGGACGCCGATCAAGAAGGCCAG
ACCAACTACGAAGACGAAGACGACAAGAACAAGCATGGCCAAGATAGCGACGCCGAAGCCGCCGCCCCCCCATCC
AAAGCCCCCAAGGTGTCCAAATCGTCGCGCCCACGAAAAAGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail