Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5098
Gene name
LocationContig_49:39930..41891
Strand+
Gene length (bp)1961
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06415 iPGM_N BPG-independent PGAM N-terminus (iPGM_N) 9.0E-70 88 320
PF01676 Metalloenzyme Metalloenzyme superfamily 2.1E-68 7 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|I6LDA6|GPMI_ONCVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onchocerca volvulus GN=ipgm-1 PE=1 SV=1 1 538 9.0E-180
sp|Q4VWF8|GPMI_BRUMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Brugia malayi GN=ipgm-1 PE=1 SV=1 1 539 1.0E-178
sp|G5EFZ1|GPMI_CAEEL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Caenorhabditis elegans GN=ipgm-1 PE=1 SV=1 6 540 2.0E-175
sp|Q1DCX8|GPMI_MYXXD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Myxococcus xanthus (strain DK 1622) GN=gpmI PE=3 SV=1 6 538 5.0E-150
sp|Q0STD7|GPMI_CLOPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain SM101 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|I6LDA6|GPMI_ONCVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onchocerca volvulus GN=ipgm-1 PE=1 SV=1 1 538 9.0E-180
sp|Q4VWF8|GPMI_BRUMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Brugia malayi GN=ipgm-1 PE=1 SV=1 1 539 1.0E-178
sp|G5EFZ1|GPMI_CAEEL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Caenorhabditis elegans GN=ipgm-1 PE=1 SV=1 6 540 2.0E-175
sp|Q1DCX8|GPMI_MYXXD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Myxococcus xanthus (strain DK 1622) GN=gpmI PE=3 SV=1 6 538 5.0E-150
sp|Q0STD7|GPMI_CLOPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain SM101 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-148
sp|Q0TQY9|GPMI_CLOP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=gpmI PE=3 SV=1 10 540 8.0E-148
sp|Q8XKU2|GPMI_CLOPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain 13 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-147
sp|B8CYG0|GPMI_HALOH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gpmI PE=3 SV=1 9 540 6.0E-146
sp|A5N2N6|GPMI_CLOK5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gpmI PE=3 SV=1 9 538 3.0E-145
sp|A6LR07|GPMI_CLOB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpmI PE=3 SV=1 9 538 6.0E-144
sp|Q3A1E5|GPMI_PELCD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gpmI PE=3 SV=1 9 538 3.0E-142
sp|A0PYP3|GPMI_CLONN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium novyi (strain NT) GN=gpmI PE=3 SV=1 9 538 2.0E-141
sp|Q747Q8|GPMI_GEOSL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmI PE=3 SV=1 9 539 3.0E-141
sp|Q2RLT9|GPMI_MOOTA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Moorella thermoacetica (strain ATCC 39073) GN=gpmI PE=3 SV=1 10 540 3.0E-141
sp|A7G9Y2|GPMI_CLOBL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gpmI PE=3 SV=1 8 538 1.0E-140
sp|A7FQN9|GPMI_CLOB1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gpmI PE=3 SV=1 8 538 5.0E-140
sp|Q8TIY2|GPMI2_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gpmI2 PE=3 SV=1 1 541 4.0E-139
sp|Q71WX0|GPMI_LISMF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gpmI PE=3 SV=1 9 540 1.0E-138
sp|Q72BL6|GPMI_DESVH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gpmI PE=3 SV=1 10 539 1.0E-138
sp|Q928I2|GPMI_LISIN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gpmI PE=3 SV=1 9 540 2.0E-138
sp|A0ALE0|GPMI_LISW6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gpmI PE=3 SV=1 9 540 5.0E-138
sp|Q8Y4I4|GPMI_LISMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gpmI PE=3 SV=1 9 540 6.0E-138
sp|A9KPF4|GPMI_CLOPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gpmI PE=3 SV=1 10 540 1.0E-136
sp|Q97L53|GPMI_CLOAB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmI PE=3 SV=1 9 538 2.0E-136
sp|B2UMU5|GPMI_AKKM8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gpmI PE=3 SV=1 10 539 4.0E-136
sp|B9KYT9|GPMI_THERP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=gpmI PE=3 SV=1 9 539 5.0E-136
sp|Q898R1|GPMI_CLOTE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium tetani (strain Massachusetts / E88) GN=gpmI PE=3 SV=1 8 538 1.0E-135
sp|Q5KVE6|GPMI_GEOKA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus kaustophilus (strain HTA426) GN=gpmI PE=3 SV=1 4 540 2.0E-135
sp|Q9X519|GPMI_GEOSE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus stearothermophilus GN=gpmI PE=1 SV=3 8 540 2.0E-135
sp|A6L050|GPMI_BACV8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gpmI PE=3 SV=1 7 538 2.0E-135
sp|Q8A287|GPMI_BACTN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmI PE=3 SV=1 7 538 2.0E-134
sp|Q3IS17|GPMI_NATPD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gpmI PE=3 SV=1 7 540 3.0E-134
sp|Q46D52|GPMI1_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gpmI1 PE=3 SV=1 10 540 9.0E-134
sp|A4ISP5|GPMI_GEOTN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gpmI PE=3 SV=1 8 540 2.0E-133
sp|Q8PYF8|GPMI_METMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gpmI PE=3 SV=1 1 540 2.0E-133
sp|Q65EN1|GPMI_BACLD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gpmI PE=3 SV=1 8 540 3.0E-133
sp|P39773|GPMI_BACSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus subtilis (strain 168) GN=gpmI PE=1 SV=4 8 540 9.0E-133
sp|B1I0X9|GPMI_DESAP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Desulforudis audaxviator (strain MP104C) GN=gpmI PE=3 SV=1 2 539 9.0E-133
sp|Q181T7|GPMI_PEPD6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Peptoclostridium difficile (strain 630) GN=gpmI PE=3 SV=1 9 540 1.0E-132
sp|Q7NMK9|GPMI_GLOVI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmI PE=3 SV=1 6 538 1.0E-132
sp|Q3MF89|GPMI_ANAVT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gpmI PE=3 SV=1 9 538 2.0E-132
sp|A6LFB1|GPMI_PARD8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gpmI PE=3 SV=1 7 538 3.0E-132
sp|A5FJ26|GPMI_FLAJ1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=gpmI PE=3 SV=1 7 538 3.0E-132
sp|Q8TMI6|GPMI1_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gpmI1 PE=3 SV=1 1 541 3.0E-132
sp|Q117D6|GPMI_TRIEI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Trichodesmium erythraeum (strain IMS101) GN=gpmI PE=3 SV=1 9 540 5.0E-132
sp|Q8YPL2|GPMI_NOSS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gpmI PE=3 SV=1 9 538 6.0E-132
sp|A7Z8Y2|GPMI_BACMF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gpmI PE=3 SV=1 8 540 4.0E-131
sp|D5DNA8|GPMI_BACMD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus megaterium (strain DSM 319) GN=gpmI PE=3 SV=1 9 538 5.0E-131
sp|Q46AE4|GPMI2_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gpmI2 PE=3 SV=1 1 541 5.0E-131
sp|Q9HU53|GPMI_PSEAE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpmI PE=3 SV=1 1 539 1.0E-130
sp|Q1IG62|GPMI_PSEE4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas entomophila (strain L48) GN=gpmI PE=3 SV=1 1 539 1.0E-130
sp|P75167|GPMI_MYCPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gpmI PE=3 SV=1 7 538 2.0E-130
sp|B2ITL6|GPMI_NOSP7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gpmI PE=3 SV=1 9 538 2.0E-130
sp|P59177|GPMI_THEEB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thermosynechococcus elongatus (strain BP-1) GN=gpmI PE=3 SV=1 10 539 5.0E-130
sp|D5DVF4|GPMI_BACMQ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=gpmI PE=3 SV=1 9 538 5.0E-130
sp|A6VDP9|GPMI_PSEA7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain PA7) GN=gpmI PE=3 SV=1 1 541 7.0E-130
sp|Q9K716|GPMI_BACHD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gpmI PE=3 SV=1 9 538 1.0E-129
sp|Q5QZA9|GPMI_IDILO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gpmI PE=3 SV=1 9 539 2.0E-129
sp|B3PGV8|GPMI_CELJU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cellvibrio japonicus (strain Ueda107) GN=gpmI PE=3 SV=1 9 539 3.0E-129
sp|A3DBQ2|GPMI_CLOTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=gpmI PE=3 SV=1 10 540 3.0E-129
sp|Q1ISS4|GPMI_KORVE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Koribacter versatilis (strain Ellin345) GN=gpmI PE=3 SV=1 1 537 5.0E-129
sp|Q67SW0|GPMI_SYMTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gpmI PE=3 SV=1 1 541 7.0E-129
sp|Q4KJR8|GPMI_PSEF5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gpmI PE=3 SV=1 1 539 9.0E-129
sp|Q1MPK8|GPMI_LAWIP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gpmI PE=3 SV=1 10 541 2.0E-128
sp|Q02EN5|GPMI_PSEAB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gpmI PE=3 SV=1 1 539 2.0E-128
sp|Q64ZN5|GPMI_BACFR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmI PE=3 SV=1 7 538 3.0E-128
sp|A5WA89|GPMI_PSEP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gpmI PE=3 SV=1 1 539 3.0E-128
sp|A8GLC2|GPMI_SERP5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Serratia proteamaculans (strain 568) GN=gpmI PE=3 SV=1 1 538 4.0E-128
sp|Q5LIL0|GPMI_BACFN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmI PE=3 SV=1 7 538 5.0E-128
sp|B0KN11|GPMI_PSEPG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain GB-1) GN=gpmI PE=3 SV=1 1 539 5.0E-128
sp|Q2SMA7|GPMI_HAHCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Hahella chejuensis (strain KCTC 2396) GN=gpmI PE=3 SV=1 10 541 1.0E-127
sp|Q2S026|GPMI_SALRD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gpmI PE=3 SV=1 3 538 2.0E-127
sp|Q2JIE9|GPMI_SYNJB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gpmI PE=3 SV=1 10 538 2.0E-127
sp|Q88CX4|GPMI_PSEPK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain KT2440) GN=gpmI PE=3 SV=1 1 539 3.0E-127
sp|C3LR68|GPMI_VIBCM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|Q9KV22|GPMI_VIBCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|A5F3N4|GPMI_VIBC3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|A7GUR8|GPMI_BACCN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpmI PE=3 SV=1 9 538 2.0E-126
sp|Q8DCW1|GPMI_VIBVU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio vulnificus (strain CMCP6) GN=gpmI PE=3 SV=2 9 538 2.0E-126
sp|B8HVP2|GPMI_CYAP4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gpmI PE=3 SV=1 9 538 3.0E-126
sp|Q7MGZ2|GPMI_VIBVY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio vulnificus (strain YJ016) GN=gpmI PE=3 SV=2 9 538 3.0E-126
sp|Q5UXB9|GPMI_HALMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gpmI PE=3 SV=1 8 538 4.0E-126
sp|Q12UT0|GPMI_METBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gpmI PE=3 SV=1 1 538 6.0E-126
sp|Q15PS5|GPMI_PSEA6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmI PE=3 SV=1 1 539 8.0E-126
sp|A8FHJ1|GPMI_BACP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus pumilus (strain SAFR-032) GN=gpmI PE=3 SV=1 8 540 8.0E-126
sp|Q72XY4|GPMI_BACC1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmI PE=3 SV=1 9 538 1.0E-125
sp|P74507|GPMI_SYNY3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gpmI PE=3 SV=1 9 542 1.0E-125
sp|A0RKS4|GPMI_BACAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmI PE=3 SV=1 9 538 1.0E-125
sp|Q3SGA3|GPMI_THIDA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gpmI PE=3 SV=1 10 538 1.0E-125
sp|Q5WDK8|GPMI_BACSK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus clausii (strain KSM-K16) GN=gpmI PE=3 SV=1 8 537 4.0E-125
sp|Q6HBF2|GPMI_BACHK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q631M1|GPMI_BACCZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q815K7|GPMI_BACCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q3KJH9|GPMI_PSEPF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gpmI PE=3 SV=1 1 539 9.0E-125
sp|Q81X77|GPMI_BACAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus anthracis GN=gpmI PE=1 SV=1 9 538 9.0E-125
sp|Q47VY2|GPMI_COLP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gpmI PE=3 SV=1 10 538 1.0E-124
sp|A7MX70|GPMI_VIBCB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gpmI PE=3 SV=1 9 538 1.0E-124
sp|C1DDB1|GPMI_LARHH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Laribacter hongkongensis (strain HLHK9) GN=gpmI PE=3 SV=1 10 538 2.0E-124
sp|Q87KZ5|GPMI_VIBPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gpmI PE=3 SV=1 9 538 4.0E-124
sp|Q7NSR8|GPMI_CHRVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gpmI PE=3 SV=1 10 538 5.0E-124
sp|Q31E77|GPMI_THICR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thiomicrospira crunogena (strain XCL-2) GN=gpmI PE=3 SV=1 10 540 5.0E-124
sp|Q1R1J7|GPMI_CHRSD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gpmI PE=3 SV=1 9 538 1.0E-123
sp|A9AYE8|GPMI_HERA2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gpmI PE=3 SV=1 3 538 2.0E-123
sp|Q49W02|GPMI_STAS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmI PE=3 SV=1 8 539 2.0E-123
sp|B0CA77|GPMI_ACAM1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acaryochloris marina (strain MBIC 11017) GN=gpmI PE=3 SV=1 9 538 3.0E-123
sp|Q8ZL56|GPMI_SALTY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmI PE=3 SV=1 1 538 4.0E-123
sp|Q5PBZ2|GPMI_SALPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmI PE=3 SV=2 1 538 4.0E-123
sp|P59174|GPMI_OCEIH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gpmI PE=3 SV=1 8 540 5.0E-123
sp|Q12HV5|GPMI_SHEDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gpmI PE=3 SV=1 1 543 5.0E-123
sp|P52832|GPMI_PSESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gpmI PE=1 SV=1 1 541 5.0E-123
sp|Q8Z2F0|GPMI_SALTI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella typhi GN=gpmI PE=3 SV=2 1 538 5.0E-123
sp|A9MVK6|GPMI_SALPB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmI PE=3 SV=1 1 538 6.0E-123
sp|A6H1H2|GPMI_FLAPJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gpmI PE=3 SV=1 7 538 7.0E-123
sp|Q8CPY4|GPMI_STAES 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmI PE=3 SV=1 9 538 8.0E-123
sp|Q5HQV1|GPMI_STAEQ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmI PE=3 SV=1 9 538 8.0E-123
sp|Q4ZLR0|GPMI_PSEU2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gpmI PE=3 SV=2 1 539 1.0E-122
sp|Q66GC2|GPMI_YERPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmI PE=3 SV=1 1 538 2.0E-122
sp|A0LDF3|GPMI_MAGMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gpmI PE=3 SV=1 10 538 2.0E-122
sp|Q2JSV1|GPMI_SYNJA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gpmI PE=3 SV=1 9 538 2.0E-122
sp|Q1GZ82|GPMI_METFK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gpmI PE=3 SV=1 8 538 2.0E-122
sp|B0JLN5|GPMI_MICAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Microcystis aeruginosa (strain NIES-843) GN=gpmI PE=3 SV=1 10 538 3.0E-122
sp|P64270|GPMI_STAAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain N315) GN=gpmI PE=1 SV=1 9 538 5.0E-122
sp|P64269|GPMI_STAAM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpmI PE=3 SV=1 9 538 5.0E-122
sp|B7K189|GPMI_CYAP8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 8801) GN=gpmI PE=3 SV=1 10 538 5.0E-122
sp|A4TSC2|GPMI_YERPP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis (strain Pestoides F) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q1CD17|GPMI_YERPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q8ZJN0|GPMI_YERPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q1C282|GPMI_YERPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q3IIE4|GPMI_PSEHT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gpmI PE=3 SV=1 4 539 8.0E-122
sp|Q57IC9|GPMI_SALCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|A7FCU8|GPMI_YERP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmI PE=3 SV=1 1 538 1.0E-121
sp|P47669|GPMI_MYCGE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gpmI PE=3 SV=1 7 541 1.0E-121
sp|A1JHY1|GPMI_YERE8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmI PE=3 SV=1 1 538 2.0E-121
sp|Q8NXL5|GPMI_STAAW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MW2) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q6GB55|GPMI_STAAS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MSSA476) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q5HHP2|GPMI_STAAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain COL) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q48C87|GPMI_PSE14 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gpmI PE=3 SV=1 1 539 4.0E-121
sp|Q6GIL5|GPMI_STAAR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MRSA252) GN=gpmI PE=3 SV=1 9 538 6.0E-121
sp|A7MID1|GPMI_CROS8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmI PE=3 SV=1 1 538 7.0E-121
sp|B9LBA2|GPMI_CHLSY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gpmI PE=3 SV=1 9 540 1.0E-120
sp|A9WJ95|GPMI_CHLAA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gpmI PE=3 SV=1 9 540 1.0E-120
sp|Q4L4K6|GPMI_STAHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpmI PE=3 SV=1 9 538 1.0E-120
sp|Q6LVL2|GPMI_PHOPR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Photobacterium profundum GN=gpmI PE=3 SV=2 9 543 2.0E-120
sp|A1S1L6|GPMI_SHEAM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gpmI PE=3 SV=1 9 539 3.0E-120
sp|Q7NAQ5|GPMI_MYCGA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gpmI PE=3 SV=1 7 538 8.0E-120
sp|A4Y077|GPMI_PSEMY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas mendocina (strain ymp) GN=gpmI PE=3 SV=1 1 538 2.0E-119
sp|A4W533|GPMI_ENT38 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmI PE=3 SV=1 1 538 2.0E-119
sp|Q5E8E9|GPMI_VIBF1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gpmI PE=3 SV=1 9 538 6.0E-119
sp|Q5ZY71|GPMI_LEGPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gpmI PE=3 SV=1 10 541 6.0E-119
sp|Q5NFB1|GPMI_FRATT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gpmI PE=3 SV=1 10 539 6.0E-119
sp|Q14GR4|GPMI_FRAT1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gpmI PE=3 SV=1 10 539 6.0E-119
sp|A0Q5M6|GPMI_FRATN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. novicida (strain U112) GN=gpmI PE=3 SV=1 10 539 9.0E-119
sp|Q0TBJ4|GPMI_ECOL5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmI PE=3 SV=1 1 538 2.0E-118
sp|A1AHE9|GPMI_ECOK1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmI PE=3 SV=1 1 538 2.0E-118
sp|P37689|GPMI_ECOLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmI PE=1 SV=1 9 538 2.0E-118
sp|Q8FCA6|GPMI_ECOL6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmI PE=3 SV=2 1 538 2.0E-118
sp|Q5WZ43|GPMI_LEGPL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Lens) GN=gpmI PE=3 SV=1 10 541 2.0E-118
sp|Q2A2B1|GPMI_FRATH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|A7NDJ7|GPMI_FRATF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|A4IZ68|GPMI_FRATW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|B5FFX7|GPMI_VIBFM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio fischeri (strain MJ11) GN=gpmI PE=3 SV=1 9 538 3.0E-118
sp|Q3YVX7|GPMI_SHISS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q31V09|GPMI_SHIBS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|B1IZH8|GPMI_ECOLC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|A8A677|GPMI_ECOHS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q8XDE9|GPMI_ECO57 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|A7ZTG6|GPMI_ECO24 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q0BKX8|GPMI_FRATO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gpmI PE=3 SV=1 10 539 4.0E-118
sp|Q329P2|GPMI_SHIDS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmI PE=3 SV=1 1 538 5.0E-118
sp|P59176|GPMI_SHIFL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella flexneri GN=gpmI PE=3 SV=1 1 538 5.0E-118
sp|B0TYM8|GPMI_FRAP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gpmI PE=3 SV=1 10 538 6.0E-118
sp|Q5X7P2|GPMI_LEGPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Paris) GN=gpmI PE=3 SV=1 10 541 2.0E-117
sp|A5IH96|GPMI_LEGPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Corby) GN=gpmI PE=3 SV=1 10 541 2.0E-117
sp|Q6B8L5|GPMI_GRATL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gracilaria tenuistipitata var. liui GN=gpmI PE=3 SV=1 10 538 2.0E-117
sp|Q7V051|GPMI_PROMP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gpmI PE=3 SV=1 5 538 3.0E-117
sp|Q18GK9|GPMI_HALWD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gpmI PE=3 SV=1 7 538 4.0E-117
sp|A2C4I0|GPMI_PROM1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain NATL1A) GN=gpmI PE=3 SV=1 9 538 4.0E-117
sp|A9KF70|GPMI_COXBN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gpmI PE=3 SV=1 9 539 6.0E-117
sp|A8HAE0|GPMI_SHEPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gpmI PE=3 SV=1 1 538 1.0E-116
sp|B7KGG1|GPMI_CYAP7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmI PE=3 SV=1 10 538 1.0E-116
sp|A9N970|GPMI_COXBR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gpmI PE=3 SV=1 9 539 2.0E-116
sp|B7VHQ4|GPMI_VIBTL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio tasmaniensis (strain LGP32) GN=gpmI PE=3 SV=1 9 538 2.0E-116
sp|Q83BH2|GPMI_COXBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gpmI PE=3 SV=1 9 539 2.0E-116
sp|Q46J72|GPMI_PROMT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain NATL2A) GN=gpmI PE=3 SV=1 9 538 2.0E-116
sp|Q7UFG7|GPMI_RHOBA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gpmI PE=3 SV=1 9 538 3.0E-116
sp|Q7VA78|GPMI_PROMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gpmI PE=3 SV=1 8 538 3.0E-116
sp|A0KR77|GPMI_SHESA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain ANA-3) GN=gpmI PE=3 SV=1 1 538 4.0E-116
sp|Q3JF23|GPMI_NITOC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpmI PE=3 SV=1 9 538 5.0E-116
sp|A8G1U9|GPMI_SHESH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sediminis (strain HAW-EB3) GN=gpmI PE=3 SV=1 1 541 6.0E-116
sp|A1SZI3|GPMI_PSYIN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Psychromonas ingrahamii (strain 37) GN=gpmI PE=3 SV=1 10 539 6.0E-116
sp|Q0I0Q6|GPMI_SHESR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain MR-7) GN=gpmI PE=3 SV=1 1 538 7.0E-116
sp|A4ST23|GPMI_AERS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Aeromonas salmonicida (strain A449) GN=gpmI PE=3 SV=1 1 538 1.0E-115
sp|A2C700|GPMI_PROM3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain MIT 9303) GN=gpmI PE=3 SV=1 9 538 2.0E-115
sp|Q0HP91|GPMI_SHESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain MR-4) GN=gpmI PE=3 SV=1 1 538 2.0E-115
sp|Q5HB16|GPMI_EHRRW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia ruminantium (strain Welgevonden) GN=gpmI PE=3 SV=1 4 538 7.0E-115
sp|A3DAN0|GPMI_SHEB5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gpmI PE=3 SV=1 1 538 7.0E-115
sp|Q7V5U5|GPMI_PROMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain MIT 9313) GN=gpmI PE=3 SV=1 9 538 1.0E-114
sp|A6WHC7|GPMI_SHEB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS185) GN=gpmI PE=3 SV=1 1 538 1.0E-114
sp|B0TLE6|GPMI_SHEHH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gpmI PE=3 SV=1 9 538 1.0E-114
sp|Q5FFL8|GPMI_EHRRG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia ruminantium (strain Gardel) GN=gpmI PE=3 SV=1 4 538 2.0E-114
sp|Q9HNY7|GPMI_HALSA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gpmI PE=3 SV=1 7 538 2.0E-114
sp|Q4FTU8|GPMI_PSYA2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gpmI PE=3 SV=1 9 538 4.0E-114
sp|A9KUB8|GPMI_SHEB9 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS195) GN=gpmI PE=3 SV=1 1 538 4.0E-114
sp|Q7VGZ8|GPMI_HELHP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gpmI PE=3 SV=1 7 532 5.0E-114
sp|B8GBF7|GPMI_CHLAD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gpmI PE=3 SV=1 9 542 9.0E-114
sp|Q06464|GPMI_ANTSP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Antithamnion sp. GN=gpmI PE=3 SV=1 10 539 1.0E-113
sp|Q3YRU6|GPMI_EHRCJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia canis (strain Jake) GN=gpmI PE=3 SV=1 4 538 2.0E-113
sp|B1XJ47|GPMI_SYNP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gpmI PE=3 SV=1 9 538 2.0E-113
sp|A4Y1E3|GPMI_SHEPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gpmI PE=3 SV=1 1 538 7.0E-113
sp|Q7U8U2|GPMI_SYNPX 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain WH8102) GN=gpmI PE=3 SV=1 10 538 8.0E-113
sp|Q5LLW1|GPMI_RUEPO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gpmI PE=3 SV=1 3 539 8.0E-113
sp|A5CVF0|GPMI_VESOH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gpmI PE=3 SV=1 1 539 2.0E-112
sp|Q5FU33|GPMI_GLUOX 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gluconobacter oxydans (strain 621H) GN=gpmI PE=3 SV=1 3 538 3.0E-112
sp|P59175|GPMI_SHEON 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella oneidensis (strain MR-1) GN=gpmI PE=3 SV=1 1 538 6.0E-112
sp|A1RQ95|GPMI_SHESW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain W3-18-1) GN=gpmI PE=3 SV=1 1 538 7.0E-112
sp|Q6FFD5|GPMI_ACIAD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gpmI PE=3 SV=1 9 539 1.0E-111
sp|A3QJM4|GPMI_SHELP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gpmI PE=3 SV=1 1 539 2.0E-111
sp|A9NF91|GPMI_ACHLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acholeplasma laidlawii (strain PG-8A) GN=gpmI PE=3 SV=1 5 540 9.0E-111
sp|A1AXW7|GPMI_RUTMC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gpmI PE=3 SV=1 1 539 2.0E-110
sp|Q2GGW3|GPMI_EHRCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gpmI PE=3 SV=1 4 538 2.0E-110
sp|Q07VW8|GPMI_SHEFN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gpmI PE=3 SV=1 10 543 2.0E-110
sp|Q8EW33|GPMI_MYCPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma penetrans (strain HF-2) GN=gpmI PE=3 SV=2 8 540 2.0E-110
sp|A1B4Z9|GPMI_PARDP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Paracoccus denitrificans (strain Pd 1222) GN=gpmI PE=3 SV=1 9 540 2.0E-110
sp|A4WWV3|GPMI_RHOS5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gpmI PE=3 SV=1 10 538 3.0E-109
sp|Q5N381|GPMI_SYNP6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gpmI PE=3 SV=1 10 538 4.0E-109
sp|Q31R18|GPMI_SYNE7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus elongatus (strain PCC 7942) GN=gpmI PE=3 SV=1 10 538 4.0E-109
sp|Q1GCX7|GPMI_RUEST 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruegeria sp. (strain TM1040) GN=gpmI PE=3 SV=1 3 538 5.0E-109
sp|P51379|GPMI_PORPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Porphyra purpurea GN=gpmI PE=3 SV=1 6 544 6.0E-109
sp|Q30Q40|GPMI_SULDN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gpmI PE=3 SV=1 7 532 2.0E-108
sp|Q21NH1|GPMI_SACD2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gpmI PE=3 SV=1 1 538 4.0E-108
sp|Q6NCX7|GPMI_RHOPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gpmI PE=3 SV=1 10 538 6.0E-108
sp|Q7M7W9|GPMI_WOLSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gpmI PE=3 SV=1 6 532 3.0E-107
sp|Q4A5A8|GPMI_MYCS5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma synoviae (strain 53) GN=gpmI PE=3 SV=2 7 540 4.0E-107
sp|Q1XDA8|GPMI_PYRYE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pyropia yezoensis GN=gpmI PE=3 SV=1 6 546 3.0E-106
sp|Q6YQT8|GPMI_ONYPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onion yellows phytoplasma (strain OY-M) GN=gpmI PE=3 SV=1 10 540 9.0E-106
sp|Q16D84|GPMI_ROSDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gpmI PE=3 SV=1 9 539 4.0E-105
sp|A8LKJ5|GPMI_DINSH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gpmI PE=3 SV=1 9 538 7.0E-105
sp|Q98QA7|GPMI_MYCPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=gpmI PE=3 SV=1 7 540 3.0E-104
sp|Q8UAA5|GPMI_AGRFC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gpmI PE=3 SV=1 4 538 6.0E-104
sp|Q73GR4|GPMI_WOLPM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolbachia pipientis wMel GN=gpmI PE=3 SV=1 10 539 7.0E-104
sp|Q2GKV7|GPMI_ANAPZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anaplasma phagocytophilum (strain HZ) GN=gpmI PE=3 SV=1 10 541 1.0E-103
sp|A3PMX9|GPMI_RHOS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|Q3IZB8|GPMI_RHOS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|B9KN62|GPMI_RHOSK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|Q2NJ40|GPMI_AYWBP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=gpmI PE=3 SV=1 10 540 9.0E-103
sp|Q5ZZU2|GPMI_MYCH2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain 232) GN=gpmI PE=3 SV=1 3 541 3.0E-102
sp|A1VYF1|GPMI_CAMJJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gpmI PE=3 SV=1 5 533 6.0E-102
sp|Q4A7D1|GPMI_MYCH7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain 7448) GN=gpmI PE=3 SV=1 7 541 2.0E-101
sp|Q9PI71|GPMI_CAMJE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gpmI PE=1 SV=1 5 533 5.0E-101
sp|Q4A992|GPMI_MYCHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=gpmI PE=3 SV=1 7 541 5.0E-101
sp|A8EW05|GPMI_ARCB4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Arcobacter butzleri (strain RM4018) GN=gpmI PE=3 SV=1 6 532 1.0E-100
sp|A8FKM1|GPMI_CAMJ8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gpmI PE=3 SV=1 5 533 1.0E-100
sp|Q5HW32|GPMI_CAMJR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni (strain RM1221) GN=gpmI PE=3 SV=1 5 533 3.0E-100
sp|A7H4U3|GPMI_CAMJD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gpmI PE=3 SV=1 5 533 5.0E-100
sp|Q5GSN3|GPMI_WOLTR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gpmI PE=3 SV=1 10 539 6.0E-100
sp|Q5PAE9|GPMI_ANAMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anaplasma marginale (strain St. Maries) GN=gpmI PE=3 SV=2 10 539 6.0E-100
sp|Q1CSQ0|GPMI_HELPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain HPAG1) GN=gpmI PE=3 SV=1 7 532 6.0E-100
sp|Q9ZKM7|GPMI_HELPJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gpmI PE=3 SV=1 7 532 1.0E-99
sp|Q6KHV9|GPMI_MYCMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=gpmI PE=3 SV=1 9 532 5.0E-99
sp|P56196|GPMI_HELPY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gpmI PE=3 SV=1 7 532 8.0E-98
sp|Q6Y8Q8|GPMI_MYCHP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=gpmI PE=3 SV=1 7 538 2.0E-97
sp|Q17X03|GPMI_HELAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter acinonychis (strain Sheeba) GN=gpmI PE=3 SV=1 7 532 7.0E-97
sp|Q6F0W3|GPMI_MESFL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=gpmI PE=3 SV=1 3 540 1.0E-89
sp|Q6MSF0|GPMI_MYCMS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=gpmI PE=3 SV=1 8 538 3.0E-89
sp|Q49006|GPMI_MYCCT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gpmI PE=3 SV=2 9 538 7.0E-89
sp|Q9L214|GPMI_STRCO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gpmI PE=3 SV=1 9 538 1.0E-82
sp|B5ZAY8|GPMI_UREU1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=gpmI PE=3 SV=1 7 540 3.0E-76
sp|Q9PQW1|GPMI_UREPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gpmI PE=3 SV=1 7 540 5.0E-75
sp|B1AIH0|GPMI_UREP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=gpmI PE=3 SV=1 7 540 5.0E-75
sp|P59173|GPMI_LEPIN Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gpmI PE=3 SV=2 7 530 2.0E-69
sp|Q72VB8|GPMI_LEPIC Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gpmI PE=3 SV=2 7 530 7.0E-69
sp|P30792|PMGI_MAIZE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Zea mays PE=1 SV=1 9 531 1.0E-66
sp|Q42908|PMGI_MESCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesembryanthemum crystallinum GN=PGM1 PE=2 SV=1 9 531 2.0E-63
sp|P35493|PMGI_RICCO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ricinus communis PE=1 SV=2 9 531 2.0E-62
sp|O04499|PMG1_ARATH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Arabidopsis thaliana GN=PGM1 PE=2 SV=3 9 531 1.0E-60
sp|P35494|PMGI_TOBAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nicotiana tabacum PE=2 SV=1 9 531 1.0E-60
sp|Q9M9K1|PMG2_ARATH Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Arabidopsis thaliana GN=At3g08590 PE=1 SV=1 10 531 9.0E-60
sp|O24246|PMGI_PRUDU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Prunus dulcis PE=2 SV=1 65 531 2.0E-53
sp|Q8L2S1|GPMI_TOBBP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Tomato big bud phytoplasma GN=gpmI PE=3 SV=1 57 128 9.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004619 phosphoglycerate mutase activity Yes
GO:0003824 catalytic activity Yes
GO:0030145 manganese ion binding Yes
GO:0005737 cytoplasm Yes
GO:0046872 metal ion binding Yes
GO:0006007 glucose catabolic process Yes
GO:0043167 ion binding No
GO:0005996 monosaccharide metabolic process No
GO:0016853 isomerase activity No
GO:0019318 hexose metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0009056 catabolic process No
GO:0044282 small molecule catabolic process No
GO:0008152 metabolic process No
GO:0019320 hexose catabolic process No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0016868 intramolecular transferase activity, phosphotransferases No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016866 intramolecular transferase activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0005975 carbohydrate metabolic process No
GO:0043169 cation binding No
GO:0006006 glucose metabolic process No
GO:0044281 small molecule metabolic process No
GO:0046365 monosaccharide catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2741
Ophiocordyceps australis map64 (Brazil) OphauB2|6594
Ophiocordyceps camponoti-floridani Ophcf2|05195
Ophiocordyceps camponoti-rufipedis Ophun1|5098 (this protein)
Ophiocordyceps kimflemingae Ophio5|6044
Ophiocordyceps subramaniannii Hirsu2|102

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5098
MPNTEHKACLIVIDGWGIPSDQSPKDGDAIAAAKTPVMDELSKHPDGFTELEASSLAVGLPEGLMGNSEVGHLNI
GAGRVVWQDVVRIDQTVKKGQLKDNQVIKKTFEGAAKGNGRLHLCGLVSHGGVVRSALPRTPICLLTMAQHSKQT
HLYALLAAAKEYGVPHVFIHFFGDGRDTDPKSGAGYMQELVDHIKELGTGQIATVVGRYYAMDRDKRWERVEKAL
KGMCHGEGETSDDPVATVKARYERGGDKDKDEFLTPIIVGGDEARIKDGDTVFFFNYRSDRARQITQLLGDVDRS
VLPDFKYPKIAKLVTMTMYKTDYPFEVAFEPQRMENVLAEWLGKQNVEQVHIAETEKYAHVTFFFNGGVEKVFPL
ETRDQDQDLVPSNKSVPTYDKAPEMSADGVADQVCKRLAEQRFPFVMNNFAPPDMVGHTGVYEAAIVGCEATDKA
IKKILDGCKKEGYILFITSDHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKQGGVLGDVAPTILAAMG
LPQPEDMTGESLLTRDLKRGAE*
Coding >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCATCGTCATTGACGGCTGGGGCATCCCCTCAGATCAGAGCCCCAAG
GATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGAGCTCTCCAAACACCCCGACGGCTTCACCGAG
CTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCATGGGCAACTCTGAGGTCGGCCATTTGAATATC
GGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCAGACCGTCAAAAAGGGTCAGCTCAAGGACAAC
CAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGGCCGCCTCCATCTCTGCGGCCTCGTCTCCCAC
GGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCTGCTGACCATGGCGCAGCACTCTAAGCAAACC
CACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCCGCACGTCTTTATCCACTTCTTTGGCGATGGG
CGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCTCGTCGACCACATCAAGGAGCTCGGCACGGGC
CAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGACAAGCGCTGGGAGCGCGTCGAGAAGGCTCTC
AAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGTAGCCACTGTCAAGGCGCGGTACGAGCGTGGC
GGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGGCGGCGACGAGGCCAGGATCAAGGACGGCGAC
ACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCGGTGACGTCGATCGGTCT
GTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACAAGACCGACTACCCGTTC
GAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGCAAAACGTCGAGCAAGTG
CACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGGAGAAGGTGTTTCCGCTG
GAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACGACAAGGCGCCCGAGATG
TCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCTTTGTCATGAACAACTTT
GCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCGAGGCCACGGACAAGGCC
ATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAGATCACGGCAACGCCGAG
GAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTTTTATCATGGCCAATGCC
CCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCATCCTGGCAGCCATGGGC
CTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTGGCGCCGAGTGA
Transcript >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCATCGTCATTGACGGCTGGGGCATCCCCTCAGATCAGAGCCCCAAG
GATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGAGCTCTCCAAACACCCCGACGGCTTCACCGAG
CTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCATGGGCAACTCTGAGGTCGGCCATTTGAATATC
GGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCAGACCGTCAAAAAGGGTCAGCTCAAGGACAAC
CAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGGCCGCCTCCATCTCTGCGGCCTCGTCTCCCAC
GGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCTGCTGACCATGGCGCAGCACTCTAAGCAAACC
CACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCCGCACGTCTTTATCCACTTCTTTGGCGATGGG
CGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCTCGTCGACCACATCAAGGAGCTCGGCACGGGC
CAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGACAAGCGCTGGGAGCGCGTCGAGAAGGCTCTC
AAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGTAGCCACTGTCAAGGCGCGGTACGAGCGTGGC
GGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGGCGGCGACGAGGCCAGGATCAAGGACGGCGAC
ACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCGGTGACGTCGATCGGTCT
GTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACAAGACCGACTACCCGTTC
GAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGCAAAACGTCGAGCAAGTG
CACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGGAGAAGGTGTTTCCGCTG
GAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACGACAAGGCGCCCGAGATG
TCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCTTTGTCATGAACAACTTT
GCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCGAGGCCACGGACAAGGCC
ATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAGATCACGGCAACGCCGAG
GAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTTTTATCATGGCCAATGCC
CCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCATCCTGGCAGCCATGGGC
CTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTGGCGCCGAGTGA
Gene >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCAGTACGTCGCCTTCCCGCTCACTGCGCCGCCGACGCCTCAGAGCC
CCTCCGTCCAAAACCCCCCCTTCGTCCAGAGCCTCTCCCCTTTCACCCAGTTCCTCATCCGGTTCCTCATCGGAT
CCGAGGCCGTCTTCGCCCCCGCGGCAGCCCTCAGACGCGCTGGTCAAGCCTCTGGACCGCGTTCTCGTCTGCTGC
TTCGTCTTGGTCTACCTCGAGGTCGGATGGCTAATTCTGTTGCTGCTTCACGAATTCAACAGTCGTCATTGACGG
CTGGGGCATCCCCTCAGATCAGAGCCCCAAGGATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGA
GCTCTCCAAACACCCCGACGGCTTCACCGAGCTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCAT
GGGCAACTCTGAGGTCGGCCATTTGAATATCGGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCA
GACCGTCAAAAAGGGTCAGCTCAAGGACAACCAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGG
CCGCCTCCATCTCTGCGGCCTCGTCTCCCACGGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCT
GCTGACCATGGCGCAGCACTCTAAGCAAACCCACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCC
GCACGTCTTTATCCACTTCTTTGGCGATGGGCGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCT
CGTCGACCACATCAAGGAGCTCGGCACGGGCCAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGA
CAAGCGCTGGGAGCGCGTCGAGAAGGCTCTCAAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGT
AGCCACTGTCAAGGCGCGGTACGAGCGTGGCGGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGG
CGGCGACGAGGCCAGGATCAAGGGTACGCCGTCATTGACCGGTTGACATCGGGGATGAAGCTGACCAAGTCCAAC
TTTTGATAGACGGCGACACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCG
GTGACGTCGATCGGTCTGTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACA
AGACCGACTACCCGTTCGAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGC
AAAACGTCGAGCAAGTGCACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGG
AGAAGGTGTTTCCGCTGGAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACG
ACAAGGCGCCCGAGATGTCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCT
TTGTCATGAACAACTTTGCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCG
AGGCCACGGACAAGGCCATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAG
ATCACGGCAACGCCGAGGAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTT
TTATCATGGCCAATGCCCCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCA
TCCTGGCAGCCATGGGCCTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTG
GCGCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail