Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5098
Gene name
LocationContig_49:39930..41891
Strand+
Gene length (bp)1961
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06415 iPGM_N BPG-independent PGAM N-terminus (iPGM_N) 9.0E-70 88 320
PF01676 Metalloenzyme Metalloenzyme superfamily 2.1E-68 7 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|I6LDA6|GPMI_ONCVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onchocerca volvulus GN=ipgm-1 PE=1 SV=1 1 538 9.0E-180
sp|Q4VWF8|GPMI_BRUMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Brugia malayi GN=ipgm-1 PE=1 SV=1 1 539 1.0E-178
sp|G5EFZ1|GPMI_CAEEL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Caenorhabditis elegans GN=ipgm-1 PE=1 SV=1 6 540 2.0E-175
sp|Q1DCX8|GPMI_MYXXD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Myxococcus xanthus (strain DK 1622) GN=gpmI PE=3 SV=1 6 538 5.0E-150
sp|Q0STD7|GPMI_CLOPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain SM101 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|I6LDA6|GPMI_ONCVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onchocerca volvulus GN=ipgm-1 PE=1 SV=1 1 538 9.0E-180
sp|Q4VWF8|GPMI_BRUMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Brugia malayi GN=ipgm-1 PE=1 SV=1 1 539 1.0E-178
sp|G5EFZ1|GPMI_CAEEL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Caenorhabditis elegans GN=ipgm-1 PE=1 SV=1 6 540 2.0E-175
sp|Q1DCX8|GPMI_MYXXD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Myxococcus xanthus (strain DK 1622) GN=gpmI PE=3 SV=1 6 538 5.0E-150
sp|Q0STD7|GPMI_CLOPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain SM101 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-148
sp|Q0TQY9|GPMI_CLOP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=gpmI PE=3 SV=1 10 540 8.0E-148
sp|Q8XKU2|GPMI_CLOPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium perfringens (strain 13 / Type A) GN=gpmI PE=3 SV=1 10 540 1.0E-147
sp|B8CYG0|GPMI_HALOH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gpmI PE=3 SV=1 9 540 6.0E-146
sp|A5N2N6|GPMI_CLOK5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gpmI PE=3 SV=1 9 538 3.0E-145
sp|A6LR07|GPMI_CLOB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpmI PE=3 SV=1 9 538 6.0E-144
sp|Q3A1E5|GPMI_PELCD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gpmI PE=3 SV=1 9 538 3.0E-142
sp|A0PYP3|GPMI_CLONN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium novyi (strain NT) GN=gpmI PE=3 SV=1 9 538 2.0E-141
sp|Q747Q8|GPMI_GEOSL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmI PE=3 SV=1 9 539 3.0E-141
sp|Q2RLT9|GPMI_MOOTA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Moorella thermoacetica (strain ATCC 39073) GN=gpmI PE=3 SV=1 10 540 3.0E-141
sp|A7G9Y2|GPMI_CLOBL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gpmI PE=3 SV=1 8 538 1.0E-140
sp|A7FQN9|GPMI_CLOB1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gpmI PE=3 SV=1 8 538 5.0E-140
sp|Q8TIY2|GPMI2_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gpmI2 PE=3 SV=1 1 541 4.0E-139
sp|Q71WX0|GPMI_LISMF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gpmI PE=3 SV=1 9 540 1.0E-138
sp|Q72BL6|GPMI_DESVH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gpmI PE=3 SV=1 10 539 1.0E-138
sp|Q928I2|GPMI_LISIN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gpmI PE=3 SV=1 9 540 2.0E-138
sp|A0ALE0|GPMI_LISW6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gpmI PE=3 SV=1 9 540 5.0E-138
sp|Q8Y4I4|GPMI_LISMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gpmI PE=3 SV=1 9 540 6.0E-138
sp|A9KPF4|GPMI_CLOPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gpmI PE=3 SV=1 10 540 1.0E-136
sp|Q97L53|GPMI_CLOAB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmI PE=3 SV=1 9 538 2.0E-136
sp|B2UMU5|GPMI_AKKM8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gpmI PE=3 SV=1 10 539 4.0E-136
sp|B9KYT9|GPMI_THERP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=gpmI PE=3 SV=1 9 539 5.0E-136
sp|Q898R1|GPMI_CLOTE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium tetani (strain Massachusetts / E88) GN=gpmI PE=3 SV=1 8 538 1.0E-135
sp|Q5KVE6|GPMI_GEOKA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus kaustophilus (strain HTA426) GN=gpmI PE=3 SV=1 4 540 2.0E-135
sp|Q9X519|GPMI_GEOSE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus stearothermophilus GN=gpmI PE=1 SV=3 8 540 2.0E-135
sp|A6L050|GPMI_BACV8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gpmI PE=3 SV=1 7 538 2.0E-135
sp|Q8A287|GPMI_BACTN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmI PE=3 SV=1 7 538 2.0E-134
sp|Q3IS17|GPMI_NATPD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gpmI PE=3 SV=1 7 540 3.0E-134
sp|Q46D52|GPMI1_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gpmI1 PE=3 SV=1 10 540 9.0E-134
sp|A4ISP5|GPMI_GEOTN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gpmI PE=3 SV=1 8 540 2.0E-133
sp|Q8PYF8|GPMI_METMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gpmI PE=3 SV=1 1 540 2.0E-133
sp|Q65EN1|GPMI_BACLD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gpmI PE=3 SV=1 8 540 3.0E-133
sp|P39773|GPMI_BACSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus subtilis (strain 168) GN=gpmI PE=1 SV=4 8 540 9.0E-133
sp|B1I0X9|GPMI_DESAP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Desulforudis audaxviator (strain MP104C) GN=gpmI PE=3 SV=1 2 539 9.0E-133
sp|Q181T7|GPMI_PEPD6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Peptoclostridium difficile (strain 630) GN=gpmI PE=3 SV=1 9 540 1.0E-132
sp|Q7NMK9|GPMI_GLOVI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmI PE=3 SV=1 6 538 1.0E-132
sp|Q3MF89|GPMI_ANAVT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gpmI PE=3 SV=1 9 538 2.0E-132
sp|A6LFB1|GPMI_PARD8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gpmI PE=3 SV=1 7 538 3.0E-132
sp|A5FJ26|GPMI_FLAJ1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=gpmI PE=3 SV=1 7 538 3.0E-132
sp|Q8TMI6|GPMI1_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gpmI1 PE=3 SV=1 1 541 3.0E-132
sp|Q117D6|GPMI_TRIEI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Trichodesmium erythraeum (strain IMS101) GN=gpmI PE=3 SV=1 9 540 5.0E-132
sp|Q8YPL2|GPMI_NOSS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gpmI PE=3 SV=1 9 538 6.0E-132
sp|A7Z8Y2|GPMI_BACMF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gpmI PE=3 SV=1 8 540 4.0E-131
sp|D5DNA8|GPMI_BACMD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus megaterium (strain DSM 319) GN=gpmI PE=3 SV=1 9 538 5.0E-131
sp|Q46AE4|GPMI2_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gpmI2 PE=3 SV=1 1 541 5.0E-131
sp|Q9HU53|GPMI_PSEAE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpmI PE=3 SV=1 1 539 1.0E-130
sp|Q1IG62|GPMI_PSEE4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas entomophila (strain L48) GN=gpmI PE=3 SV=1 1 539 1.0E-130
sp|P75167|GPMI_MYCPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gpmI PE=3 SV=1 7 538 2.0E-130
sp|B2ITL6|GPMI_NOSP7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gpmI PE=3 SV=1 9 538 2.0E-130
sp|P59177|GPMI_THEEB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thermosynechococcus elongatus (strain BP-1) GN=gpmI PE=3 SV=1 10 539 5.0E-130
sp|D5DVF4|GPMI_BACMQ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=gpmI PE=3 SV=1 9 538 5.0E-130
sp|A6VDP9|GPMI_PSEA7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain PA7) GN=gpmI PE=3 SV=1 1 541 7.0E-130
sp|Q9K716|GPMI_BACHD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gpmI PE=3 SV=1 9 538 1.0E-129
sp|Q5QZA9|GPMI_IDILO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gpmI PE=3 SV=1 9 539 2.0E-129
sp|B3PGV8|GPMI_CELJU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cellvibrio japonicus (strain Ueda107) GN=gpmI PE=3 SV=1 9 539 3.0E-129
sp|A3DBQ2|GPMI_CLOTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=gpmI PE=3 SV=1 10 540 3.0E-129
sp|Q1ISS4|GPMI_KORVE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Koribacter versatilis (strain Ellin345) GN=gpmI PE=3 SV=1 1 537 5.0E-129
sp|Q67SW0|GPMI_SYMTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gpmI PE=3 SV=1 1 541 7.0E-129
sp|Q4KJR8|GPMI_PSEF5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gpmI PE=3 SV=1 1 539 9.0E-129
sp|Q1MPK8|GPMI_LAWIP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gpmI PE=3 SV=1 10 541 2.0E-128
sp|Q02EN5|GPMI_PSEAB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gpmI PE=3 SV=1 1 539 2.0E-128
sp|Q64ZN5|GPMI_BACFR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmI PE=3 SV=1 7 538 3.0E-128
sp|A5WA89|GPMI_PSEP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gpmI PE=3 SV=1 1 539 3.0E-128
sp|A8GLC2|GPMI_SERP5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Serratia proteamaculans (strain 568) GN=gpmI PE=3 SV=1 1 538 4.0E-128
sp|Q5LIL0|GPMI_BACFN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmI PE=3 SV=1 7 538 5.0E-128
sp|B0KN11|GPMI_PSEPG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain GB-1) GN=gpmI PE=3 SV=1 1 539 5.0E-128
sp|Q2SMA7|GPMI_HAHCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Hahella chejuensis (strain KCTC 2396) GN=gpmI PE=3 SV=1 10 541 1.0E-127
sp|Q2S026|GPMI_SALRD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gpmI PE=3 SV=1 3 538 2.0E-127
sp|Q2JIE9|GPMI_SYNJB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gpmI PE=3 SV=1 10 538 2.0E-127
sp|Q88CX4|GPMI_PSEPK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas putida (strain KT2440) GN=gpmI PE=3 SV=1 1 539 3.0E-127
sp|C3LR68|GPMI_VIBCM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|Q9KV22|GPMI_VIBCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|A5F3N4|GPMI_VIBC3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gpmI PE=3 SV=1 9 539 3.0E-127
sp|A7GUR8|GPMI_BACCN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpmI PE=3 SV=1 9 538 2.0E-126
sp|Q8DCW1|GPMI_VIBVU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio vulnificus (strain CMCP6) GN=gpmI PE=3 SV=2 9 538 2.0E-126
sp|B8HVP2|GPMI_CYAP4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gpmI PE=3 SV=1 9 538 3.0E-126
sp|Q7MGZ2|GPMI_VIBVY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio vulnificus (strain YJ016) GN=gpmI PE=3 SV=2 9 538 3.0E-126
sp|Q5UXB9|GPMI_HALMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gpmI PE=3 SV=1 8 538 4.0E-126
sp|Q12UT0|GPMI_METBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gpmI PE=3 SV=1 1 538 6.0E-126
sp|Q15PS5|GPMI_PSEA6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmI PE=3 SV=1 1 539 8.0E-126
sp|A8FHJ1|GPMI_BACP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus pumilus (strain SAFR-032) GN=gpmI PE=3 SV=1 8 540 8.0E-126
sp|Q72XY4|GPMI_BACC1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmI PE=3 SV=1 9 538 1.0E-125
sp|P74507|GPMI_SYNY3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gpmI PE=3 SV=1 9 542 1.0E-125
sp|A0RKS4|GPMI_BACAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmI PE=3 SV=1 9 538 1.0E-125
sp|Q3SGA3|GPMI_THIDA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gpmI PE=3 SV=1 10 538 1.0E-125
sp|Q5WDK8|GPMI_BACSK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus clausii (strain KSM-K16) GN=gpmI PE=3 SV=1 8 537 4.0E-125
sp|Q6HBF2|GPMI_BACHK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q631M1|GPMI_BACCZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q815K7|GPMI_BACCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpmI PE=3 SV=1 9 538 8.0E-125
sp|Q3KJH9|GPMI_PSEPF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gpmI PE=3 SV=1 1 539 9.0E-125
sp|Q81X77|GPMI_BACAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus anthracis GN=gpmI PE=1 SV=1 9 538 9.0E-125
sp|Q47VY2|GPMI_COLP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gpmI PE=3 SV=1 10 538 1.0E-124
sp|A7MX70|GPMI_VIBCB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gpmI PE=3 SV=1 9 538 1.0E-124
sp|C1DDB1|GPMI_LARHH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Laribacter hongkongensis (strain HLHK9) GN=gpmI PE=3 SV=1 10 538 2.0E-124
sp|Q87KZ5|GPMI_VIBPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gpmI PE=3 SV=1 9 538 4.0E-124
sp|Q7NSR8|GPMI_CHRVO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gpmI PE=3 SV=1 10 538 5.0E-124
sp|Q31E77|GPMI_THICR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Thiomicrospira crunogena (strain XCL-2) GN=gpmI PE=3 SV=1 10 540 5.0E-124
sp|Q1R1J7|GPMI_CHRSD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gpmI PE=3 SV=1 9 538 1.0E-123
sp|A9AYE8|GPMI_HERA2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gpmI PE=3 SV=1 3 538 2.0E-123
sp|Q49W02|GPMI_STAS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmI PE=3 SV=1 8 539 2.0E-123
sp|B0CA77|GPMI_ACAM1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acaryochloris marina (strain MBIC 11017) GN=gpmI PE=3 SV=1 9 538 3.0E-123
sp|Q8ZL56|GPMI_SALTY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmI PE=3 SV=1 1 538 4.0E-123
sp|Q5PBZ2|GPMI_SALPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmI PE=3 SV=2 1 538 4.0E-123
sp|P59174|GPMI_OCEIH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gpmI PE=3 SV=1 8 540 5.0E-123
sp|Q12HV5|GPMI_SHEDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gpmI PE=3 SV=1 1 543 5.0E-123
sp|P52832|GPMI_PSESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gpmI PE=1 SV=1 1 541 5.0E-123
sp|Q8Z2F0|GPMI_SALTI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella typhi GN=gpmI PE=3 SV=2 1 538 5.0E-123
sp|A9MVK6|GPMI_SALPB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmI PE=3 SV=1 1 538 6.0E-123
sp|A6H1H2|GPMI_FLAPJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gpmI PE=3 SV=1 7 538 7.0E-123
sp|Q8CPY4|GPMI_STAES 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmI PE=3 SV=1 9 538 8.0E-123
sp|Q5HQV1|GPMI_STAEQ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmI PE=3 SV=1 9 538 8.0E-123
sp|Q4ZLR0|GPMI_PSEU2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gpmI PE=3 SV=2 1 539 1.0E-122
sp|Q66GC2|GPMI_YERPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmI PE=3 SV=1 1 538 2.0E-122
sp|A0LDF3|GPMI_MAGMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gpmI PE=3 SV=1 10 538 2.0E-122
sp|Q2JSV1|GPMI_SYNJA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gpmI PE=3 SV=1 9 538 2.0E-122
sp|Q1GZ82|GPMI_METFK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gpmI PE=3 SV=1 8 538 2.0E-122
sp|B0JLN5|GPMI_MICAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Microcystis aeruginosa (strain NIES-843) GN=gpmI PE=3 SV=1 10 538 3.0E-122
sp|P64270|GPMI_STAAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain N315) GN=gpmI PE=1 SV=1 9 538 5.0E-122
sp|P64269|GPMI_STAAM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpmI PE=3 SV=1 9 538 5.0E-122
sp|B7K189|GPMI_CYAP8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 8801) GN=gpmI PE=3 SV=1 10 538 5.0E-122
sp|A4TSC2|GPMI_YERPP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis (strain Pestoides F) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q1CD17|GPMI_YERPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q8ZJN0|GPMI_YERPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q1C282|GPMI_YERPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|Q3IIE4|GPMI_PSEHT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gpmI PE=3 SV=1 4 539 8.0E-122
sp|Q57IC9|GPMI_SALCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmI PE=3 SV=1 1 538 8.0E-122
sp|A7FCU8|GPMI_YERP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmI PE=3 SV=1 1 538 1.0E-121
sp|P47669|GPMI_MYCGE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gpmI PE=3 SV=1 7 541 1.0E-121
sp|A1JHY1|GPMI_YERE8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmI PE=3 SV=1 1 538 2.0E-121
sp|Q8NXL5|GPMI_STAAW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MW2) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q6GB55|GPMI_STAAS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MSSA476) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q5HHP2|GPMI_STAAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain COL) GN=gpmI PE=3 SV=1 9 538 3.0E-121
sp|Q48C87|GPMI_PSE14 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gpmI PE=3 SV=1 1 539 4.0E-121
sp|Q6GIL5|GPMI_STAAR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus aureus (strain MRSA252) GN=gpmI PE=3 SV=1 9 538 6.0E-121
sp|A7MID1|GPMI_CROS8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmI PE=3 SV=1 1 538 7.0E-121
sp|B9LBA2|GPMI_CHLSY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gpmI PE=3 SV=1 9 540 1.0E-120
sp|A9WJ95|GPMI_CHLAA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gpmI PE=3 SV=1 9 540 1.0E-120
sp|Q4L4K6|GPMI_STAHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpmI PE=3 SV=1 9 538 1.0E-120
sp|Q6LVL2|GPMI_PHOPR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Photobacterium profundum GN=gpmI PE=3 SV=2 9 543 2.0E-120
sp|A1S1L6|GPMI_SHEAM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gpmI PE=3 SV=1 9 539 3.0E-120
sp|Q7NAQ5|GPMI_MYCGA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gpmI PE=3 SV=1 7 538 8.0E-120
sp|A4Y077|GPMI_PSEMY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pseudomonas mendocina (strain ymp) GN=gpmI PE=3 SV=1 1 538 2.0E-119
sp|A4W533|GPMI_ENT38 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmI PE=3 SV=1 1 538 2.0E-119
sp|Q5E8E9|GPMI_VIBF1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gpmI PE=3 SV=1 9 538 6.0E-119
sp|Q5ZY71|GPMI_LEGPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gpmI PE=3 SV=1 10 541 6.0E-119
sp|Q5NFB1|GPMI_FRATT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gpmI PE=3 SV=1 10 539 6.0E-119
sp|Q14GR4|GPMI_FRAT1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gpmI PE=3 SV=1 10 539 6.0E-119
sp|A0Q5M6|GPMI_FRATN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. novicida (strain U112) GN=gpmI PE=3 SV=1 10 539 9.0E-119
sp|Q0TBJ4|GPMI_ECOL5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmI PE=3 SV=1 1 538 2.0E-118
sp|A1AHE9|GPMI_ECOK1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmI PE=3 SV=1 1 538 2.0E-118
sp|P37689|GPMI_ECOLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmI PE=1 SV=1 9 538 2.0E-118
sp|Q8FCA6|GPMI_ECOL6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmI PE=3 SV=2 1 538 2.0E-118
sp|Q5WZ43|GPMI_LEGPL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Lens) GN=gpmI PE=3 SV=1 10 541 2.0E-118
sp|Q2A2B1|GPMI_FRATH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|A7NDJ7|GPMI_FRATF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|A4IZ68|GPMI_FRATW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gpmI PE=3 SV=1 10 539 3.0E-118
sp|B5FFX7|GPMI_VIBFM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio fischeri (strain MJ11) GN=gpmI PE=3 SV=1 9 538 3.0E-118
sp|Q3YVX7|GPMI_SHISS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q31V09|GPMI_SHIBS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|B1IZH8|GPMI_ECOLC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|A8A677|GPMI_ECOHS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q8XDE9|GPMI_ECO57 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|A7ZTG6|GPMI_ECO24 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmI PE=3 SV=1 1 538 3.0E-118
sp|Q0BKX8|GPMI_FRATO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gpmI PE=3 SV=1 10 539 4.0E-118
sp|Q329P2|GPMI_SHIDS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmI PE=3 SV=1 1 538 5.0E-118
sp|P59176|GPMI_SHIFL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shigella flexneri GN=gpmI PE=3 SV=1 1 538 5.0E-118
sp|B0TYM8|GPMI_FRAP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gpmI PE=3 SV=1 10 538 6.0E-118
sp|Q5X7P2|GPMI_LEGPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Paris) GN=gpmI PE=3 SV=1 10 541 2.0E-117
sp|A5IH96|GPMI_LEGPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Legionella pneumophila (strain Corby) GN=gpmI PE=3 SV=1 10 541 2.0E-117
sp|Q6B8L5|GPMI_GRATL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gracilaria tenuistipitata var. liui GN=gpmI PE=3 SV=1 10 538 2.0E-117
sp|Q7V051|GPMI_PROMP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gpmI PE=3 SV=1 5 538 3.0E-117
sp|Q18GK9|GPMI_HALWD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gpmI PE=3 SV=1 7 538 4.0E-117
sp|A2C4I0|GPMI_PROM1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain NATL1A) GN=gpmI PE=3 SV=1 9 538 4.0E-117
sp|A9KF70|GPMI_COXBN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gpmI PE=3 SV=1 9 539 6.0E-117
sp|A8HAE0|GPMI_SHEPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gpmI PE=3 SV=1 1 538 1.0E-116
sp|B7KGG1|GPMI_CYAP7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmI PE=3 SV=1 10 538 1.0E-116
sp|A9N970|GPMI_COXBR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gpmI PE=3 SV=1 9 539 2.0E-116
sp|B7VHQ4|GPMI_VIBTL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vibrio tasmaniensis (strain LGP32) GN=gpmI PE=3 SV=1 9 538 2.0E-116
sp|Q83BH2|GPMI_COXBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gpmI PE=3 SV=1 9 539 2.0E-116
sp|Q46J72|GPMI_PROMT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain NATL2A) GN=gpmI PE=3 SV=1 9 538 2.0E-116
sp|Q7UFG7|GPMI_RHOBA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gpmI PE=3 SV=1 9 538 3.0E-116
sp|Q7VA78|GPMI_PROMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gpmI PE=3 SV=1 8 538 3.0E-116
sp|A0KR77|GPMI_SHESA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain ANA-3) GN=gpmI PE=3 SV=1 1 538 4.0E-116
sp|Q3JF23|GPMI_NITOC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpmI PE=3 SV=1 9 538 5.0E-116
sp|A8G1U9|GPMI_SHESH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sediminis (strain HAW-EB3) GN=gpmI PE=3 SV=1 1 541 6.0E-116
sp|A1SZI3|GPMI_PSYIN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Psychromonas ingrahamii (strain 37) GN=gpmI PE=3 SV=1 10 539 6.0E-116
sp|Q0I0Q6|GPMI_SHESR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain MR-7) GN=gpmI PE=3 SV=1 1 538 7.0E-116
sp|A4ST23|GPMI_AERS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Aeromonas salmonicida (strain A449) GN=gpmI PE=3 SV=1 1 538 1.0E-115
sp|A2C700|GPMI_PROM3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain MIT 9303) GN=gpmI PE=3 SV=1 9 538 2.0E-115
sp|Q0HP91|GPMI_SHESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain MR-4) GN=gpmI PE=3 SV=1 1 538 2.0E-115
sp|Q5HB16|GPMI_EHRRW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia ruminantium (strain Welgevonden) GN=gpmI PE=3 SV=1 4 538 7.0E-115
sp|A3DAN0|GPMI_SHEB5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gpmI PE=3 SV=1 1 538 7.0E-115
sp|Q7V5U5|GPMI_PROMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Prochlorococcus marinus (strain MIT 9313) GN=gpmI PE=3 SV=1 9 538 1.0E-114
sp|A6WHC7|GPMI_SHEB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS185) GN=gpmI PE=3 SV=1 1 538 1.0E-114
sp|B0TLE6|GPMI_SHEHH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gpmI PE=3 SV=1 9 538 1.0E-114
sp|Q5FFL8|GPMI_EHRRG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia ruminantium (strain Gardel) GN=gpmI PE=3 SV=1 4 538 2.0E-114
sp|Q9HNY7|GPMI_HALSA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gpmI PE=3 SV=1 7 538 2.0E-114
sp|Q4FTU8|GPMI_PSYA2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gpmI PE=3 SV=1 9 538 4.0E-114
sp|A9KUB8|GPMI_SHEB9 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella baltica (strain OS195) GN=gpmI PE=3 SV=1 1 538 4.0E-114
sp|Q7VGZ8|GPMI_HELHP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gpmI PE=3 SV=1 7 532 5.0E-114
sp|B8GBF7|GPMI_CHLAD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gpmI PE=3 SV=1 9 542 9.0E-114
sp|Q06464|GPMI_ANTSP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Antithamnion sp. GN=gpmI PE=3 SV=1 10 539 1.0E-113
sp|Q3YRU6|GPMI_EHRCJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia canis (strain Jake) GN=gpmI PE=3 SV=1 4 538 2.0E-113
sp|B1XJ47|GPMI_SYNP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gpmI PE=3 SV=1 9 538 2.0E-113
sp|A4Y1E3|GPMI_SHEPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gpmI PE=3 SV=1 1 538 7.0E-113
sp|Q7U8U2|GPMI_SYNPX 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain WH8102) GN=gpmI PE=3 SV=1 10 538 8.0E-113
sp|Q5LLW1|GPMI_RUEPO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gpmI PE=3 SV=1 3 539 8.0E-113
sp|A5CVF0|GPMI_VESOH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gpmI PE=3 SV=1 1 539 2.0E-112
sp|Q5FU33|GPMI_GLUOX 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Gluconobacter oxydans (strain 621H) GN=gpmI PE=3 SV=1 3 538 3.0E-112
sp|P59175|GPMI_SHEON 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella oneidensis (strain MR-1) GN=gpmI PE=3 SV=1 1 538 6.0E-112
sp|A1RQ95|GPMI_SHESW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella sp. (strain W3-18-1) GN=gpmI PE=3 SV=1 1 538 7.0E-112
sp|Q6FFD5|GPMI_ACIAD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gpmI PE=3 SV=1 9 539 1.0E-111
sp|A3QJM4|GPMI_SHELP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gpmI PE=3 SV=1 1 539 2.0E-111
sp|A9NF91|GPMI_ACHLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Acholeplasma laidlawii (strain PG-8A) GN=gpmI PE=3 SV=1 5 540 9.0E-111
sp|A1AXW7|GPMI_RUTMC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gpmI PE=3 SV=1 1 539 2.0E-110
sp|Q2GGW3|GPMI_EHRCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gpmI PE=3 SV=1 4 538 2.0E-110
sp|Q07VW8|GPMI_SHEFN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gpmI PE=3 SV=1 10 543 2.0E-110
sp|Q8EW33|GPMI_MYCPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma penetrans (strain HF-2) GN=gpmI PE=3 SV=2 8 540 2.0E-110
sp|A1B4Z9|GPMI_PARDP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Paracoccus denitrificans (strain Pd 1222) GN=gpmI PE=3 SV=1 9 540 2.0E-110
sp|A4WWV3|GPMI_RHOS5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gpmI PE=3 SV=1 10 538 3.0E-109
sp|Q5N381|GPMI_SYNP6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gpmI PE=3 SV=1 10 538 4.0E-109
sp|Q31R18|GPMI_SYNE7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Synechococcus elongatus (strain PCC 7942) GN=gpmI PE=3 SV=1 10 538 4.0E-109
sp|Q1GCX7|GPMI_RUEST 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ruegeria sp. (strain TM1040) GN=gpmI PE=3 SV=1 3 538 5.0E-109
sp|P51379|GPMI_PORPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Porphyra purpurea GN=gpmI PE=3 SV=1 6 544 6.0E-109
sp|Q30Q40|GPMI_SULDN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gpmI PE=3 SV=1 7 532 2.0E-108
sp|Q21NH1|GPMI_SACD2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gpmI PE=3 SV=1 1 538 4.0E-108
sp|Q6NCX7|GPMI_RHOPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gpmI PE=3 SV=1 10 538 6.0E-108
sp|Q7M7W9|GPMI_WOLSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gpmI PE=3 SV=1 6 532 3.0E-107
sp|Q4A5A8|GPMI_MYCS5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma synoviae (strain 53) GN=gpmI PE=3 SV=2 7 540 4.0E-107
sp|Q1XDA8|GPMI_PYRYE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Pyropia yezoensis GN=gpmI PE=3 SV=1 6 546 3.0E-106
sp|Q6YQT8|GPMI_ONYPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Onion yellows phytoplasma (strain OY-M) GN=gpmI PE=3 SV=1 10 540 9.0E-106
sp|Q16D84|GPMI_ROSDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gpmI PE=3 SV=1 9 539 4.0E-105
sp|A8LKJ5|GPMI_DINSH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gpmI PE=3 SV=1 9 538 7.0E-105
sp|Q98QA7|GPMI_MYCPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=gpmI PE=3 SV=1 7 540 3.0E-104
sp|Q8UAA5|GPMI_AGRFC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gpmI PE=3 SV=1 4 538 6.0E-104
sp|Q73GR4|GPMI_WOLPM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolbachia pipientis wMel GN=gpmI PE=3 SV=1 10 539 7.0E-104
sp|Q2GKV7|GPMI_ANAPZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anaplasma phagocytophilum (strain HZ) GN=gpmI PE=3 SV=1 10 541 1.0E-103
sp|A3PMX9|GPMI_RHOS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|Q3IZB8|GPMI_RHOS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|B9KN62|GPMI_RHOSK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gpmI PE=3 SV=1 9 538 2.0E-103
sp|Q2NJ40|GPMI_AYWBP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=gpmI PE=3 SV=1 10 540 9.0E-103
sp|Q5ZZU2|GPMI_MYCH2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain 232) GN=gpmI PE=3 SV=1 3 541 3.0E-102
sp|A1VYF1|GPMI_CAMJJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gpmI PE=3 SV=1 5 533 6.0E-102
sp|Q4A7D1|GPMI_MYCH7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain 7448) GN=gpmI PE=3 SV=1 7 541 2.0E-101
sp|Q9PI71|GPMI_CAMJE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gpmI PE=1 SV=1 5 533 5.0E-101
sp|Q4A992|GPMI_MYCHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=gpmI PE=3 SV=1 7 541 5.0E-101
sp|A8EW05|GPMI_ARCB4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Arcobacter butzleri (strain RM4018) GN=gpmI PE=3 SV=1 6 532 1.0E-100
sp|A8FKM1|GPMI_CAMJ8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gpmI PE=3 SV=1 5 533 1.0E-100
sp|Q5HW32|GPMI_CAMJR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni (strain RM1221) GN=gpmI PE=3 SV=1 5 533 3.0E-100
sp|A7H4U3|GPMI_CAMJD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gpmI PE=3 SV=1 5 533 5.0E-100
sp|Q5GSN3|GPMI_WOLTR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gpmI PE=3 SV=1 10 539 6.0E-100
sp|Q5PAE9|GPMI_ANAMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Anaplasma marginale (strain St. Maries) GN=gpmI PE=3 SV=2 10 539 6.0E-100
sp|Q1CSQ0|GPMI_HELPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain HPAG1) GN=gpmI PE=3 SV=1 7 532 6.0E-100
sp|Q9ZKM7|GPMI_HELPJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gpmI PE=3 SV=1 7 532 1.0E-99
sp|Q6KHV9|GPMI_MYCMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=gpmI PE=3 SV=1 9 532 5.0E-99
sp|P56196|GPMI_HELPY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gpmI PE=3 SV=1 7 532 8.0E-98
sp|Q6Y8Q8|GPMI_MYCHP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=gpmI PE=3 SV=1 7 538 2.0E-97
sp|Q17X03|GPMI_HELAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Helicobacter acinonychis (strain Sheeba) GN=gpmI PE=3 SV=1 7 532 7.0E-97
sp|Q6F0W3|GPMI_MESFL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=gpmI PE=3 SV=1 3 540 1.0E-89
sp|Q6MSF0|GPMI_MYCMS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=gpmI PE=3 SV=1 8 538 3.0E-89
sp|Q49006|GPMI_MYCCT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gpmI PE=3 SV=2 9 538 7.0E-89
sp|Q9L214|GPMI_STRCO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gpmI PE=3 SV=1 9 538 1.0E-82
sp|B5ZAY8|GPMI_UREU1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=gpmI PE=3 SV=1 7 540 3.0E-76
sp|Q9PQW1|GPMI_UREPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gpmI PE=3 SV=1 7 540 5.0E-75
sp|B1AIH0|GPMI_UREP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=gpmI PE=3 SV=1 7 540 5.0E-75
sp|P59173|GPMI_LEPIN Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gpmI PE=3 SV=2 7 530 2.0E-69
sp|Q72VB8|GPMI_LEPIC Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gpmI PE=3 SV=2 7 530 7.0E-69
sp|P30792|PMGI_MAIZE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Zea mays PE=1 SV=1 9 531 1.0E-66
sp|Q42908|PMGI_MESCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesembryanthemum crystallinum GN=PGM1 PE=2 SV=1 9 531 2.0E-63
sp|P35493|PMGI_RICCO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ricinus communis PE=1 SV=2 9 531 2.0E-62
sp|O04499|PMG1_ARATH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Arabidopsis thaliana GN=PGM1 PE=2 SV=3 9 531 1.0E-60
sp|P35494|PMGI_TOBAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nicotiana tabacum PE=2 SV=1 9 531 1.0E-60
sp|Q9M9K1|PMG2_ARATH Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Arabidopsis thaliana GN=At3g08590 PE=1 SV=1 10 531 9.0E-60
sp|O24246|PMGI_PRUDU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Prunus dulcis PE=2 SV=1 65 531 2.0E-53
sp|Q8L2S1|GPMI_TOBBP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Tomato big bud phytoplasma GN=gpmI PE=3 SV=1 57 128 9.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004619 phosphoglycerate mutase activity Yes
GO:0003824 catalytic activity Yes
GO:0030145 manganese ion binding Yes
GO:0005737 cytoplasm Yes
GO:0046872 metal ion binding Yes
GO:0006007 glucose catabolic process Yes
GO:0043167 ion binding No
GO:0005996 monosaccharide metabolic process No
GO:0016853 isomerase activity No
GO:0019318 hexose metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0009056 catabolic process No
GO:0044282 small molecule catabolic process No
GO:0008152 metabolic process No
GO:0019320 hexose catabolic process No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0016868 intramolecular transferase activity, phosphotransferases No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016866 intramolecular transferase activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0005975 carbohydrate metabolic process No
GO:0043169 cation binding No
GO:0006006 glucose metabolic process No
GO:0044281 small molecule metabolic process No
GO:0046365 monosaccharide catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5098
MPNTEHKACLIVIDGWGIPSDQSPKDGDAIAAAKTPVMDELSKHPDGFTELEASSLAVGLPEGLMGNSEVGHLNI
GAGRVVWQDVVRIDQTVKKGQLKDNQVIKKTFEGAAKGNGRLHLCGLVSHGGVVRSALPRTPICLLTMAQHSKQT
HLYALLAAAKEYGVPHVFIHFFGDGRDTDPKSGAGYMQELVDHIKELGTGQIATVVGRYYAMDRDKRWERVEKAL
KGMCHGEGETSDDPVATVKARYERGGDKDKDEFLTPIIVGGDEARIKDGDTVFFFNYRSDRARQITQLLGDVDRS
VLPDFKYPKIAKLVTMTMYKTDYPFEVAFEPQRMENVLAEWLGKQNVEQVHIAETEKYAHVTFFFNGGVEKVFPL
ETRDQDQDLVPSNKSVPTYDKAPEMSADGVADQVCKRLAEQRFPFVMNNFAPPDMVGHTGVYEAAIVGCEATDKA
IKKILDGCKKEGYILFITSDHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKQGGVLGDVAPTILAAMG
LPQPEDMTGESLLTRDLKRGAE*
Coding >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCATCGTCATTGACGGCTGGGGCATCCCCTCAGATCAGAGCCCCAAG
GATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGAGCTCTCCAAACACCCCGACGGCTTCACCGAG
CTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCATGGGCAACTCTGAGGTCGGCCATTTGAATATC
GGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCAGACCGTCAAAAAGGGTCAGCTCAAGGACAAC
CAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGGCCGCCTCCATCTCTGCGGCCTCGTCTCCCAC
GGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCTGCTGACCATGGCGCAGCACTCTAAGCAAACC
CACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCCGCACGTCTTTATCCACTTCTTTGGCGATGGG
CGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCTCGTCGACCACATCAAGGAGCTCGGCACGGGC
CAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGACAAGCGCTGGGAGCGCGTCGAGAAGGCTCTC
AAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGTAGCCACTGTCAAGGCGCGGTACGAGCGTGGC
GGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGGCGGCGACGAGGCCAGGATCAAGGACGGCGAC
ACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCGGTGACGTCGATCGGTCT
GTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACAAGACCGACTACCCGTTC
GAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGCAAAACGTCGAGCAAGTG
CACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGGAGAAGGTGTTTCCGCTG
GAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACGACAAGGCGCCCGAGATG
TCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCTTTGTCATGAACAACTTT
GCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCGAGGCCACGGACAAGGCC
ATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAGATCACGGCAACGCCGAG
GAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTTTTATCATGGCCAATGCC
CCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCATCCTGGCAGCCATGGGC
CTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTGGCGCCGAGTGA
Transcript >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCATCGTCATTGACGGCTGGGGCATCCCCTCAGATCAGAGCCCCAAG
GATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGAGCTCTCCAAACACCCCGACGGCTTCACCGAG
CTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCATGGGCAACTCTGAGGTCGGCCATTTGAATATC
GGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCAGACCGTCAAAAAGGGTCAGCTCAAGGACAAC
CAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGGCCGCCTCCATCTCTGCGGCCTCGTCTCCCAC
GGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCTGCTGACCATGGCGCAGCACTCTAAGCAAACC
CACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCCGCACGTCTTTATCCACTTCTTTGGCGATGGG
CGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCTCGTCGACCACATCAAGGAGCTCGGCACGGGC
CAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGACAAGCGCTGGGAGCGCGTCGAGAAGGCTCTC
AAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGTAGCCACTGTCAAGGCGCGGTACGAGCGTGGC
GGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGGCGGCGACGAGGCCAGGATCAAGGACGGCGAC
ACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCGGTGACGTCGATCGGTCT
GTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACAAGACCGACTACCCGTTC
GAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGCAAAACGTCGAGCAAGTG
CACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGGAGAAGGTGTTTCCGCTG
GAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACGACAAGGCGCCCGAGATG
TCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCTTTGTCATGAACAACTTT
GCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCGAGGCCACGGACAAGGCC
ATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAGATCACGGCAACGCCGAG
GAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTTTTATCATGGCCAATGCC
CCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCATCCTGGCAGCCATGGGC
CTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTGGCGCCGAGTGA
Gene >Ophun1|5098
ATGCCAAATACCGAGCACAAAGCCTGCCTCAGTACGTCGCCTTCCCGCTCACTGCGCCGCCGACGCCTCAGAGCC
CCTCCGTCCAAAACCCCCCCTTCGTCCAGAGCCTCTCCCCTTTCACCCAGTTCCTCATCCGGTTCCTCATCGGAT
CCGAGGCCGTCTTCGCCCCCGCGGCAGCCCTCAGACGCGCTGGTCAAGCCTCTGGACCGCGTTCTCGTCTGCTGC
TTCGTCTTGGTCTACCTCGAGGTCGGATGGCTAATTCTGTTGCTGCTTCACGAATTCAACAGTCGTCATTGACGG
CTGGGGCATCCCCTCAGATCAGAGCCCCAAGGATGGCGACGCCATTGCCGCTGCCAAGACACCCGTCATGGACGA
GCTCTCCAAACACCCCGACGGCTTCACCGAGCTCGAGGCTTCGTCGCTCGCCGTCGGACTGCCCGAGGGCCTCAT
GGGCAACTCTGAGGTCGGCCATTTGAATATCGGCGCCGGTCGCGTCGTCTGGCAGGATGTTGTTCGCATCGACCA
GACCGTCAAAAAGGGTCAGCTCAAGGACAACCAAGTCATCAAGAAGACGTTTGAGGGCGCCGCAAAGGGCAACGG
CCGCCTCCATCTCTGCGGCCTCGTCTCCCACGGCGGCGTTGTACGCTCAGCCCTCCCCCGGACCCCGATATGTCT
GCTGACCATGGCGCAGCACTCTAAGCAAACCCACCTGTACGCCCTCCTCGCCGCGGCAAAGGAGTACGGCGTTCC
GCACGTCTTTATCCACTTCTTTGGCGATGGGCGCGATACCGACCCCAAGTCGGGCGCCGGATACATGCAGGAGCT
CGTCGACCACATCAAGGAGCTCGGCACGGGCCAGATCGCCACCGTCGTCGGCCGCTACTACGCCATGGACCGCGA
CAAGCGCTGGGAGCGCGTCGAGAAGGCTCTCAAGGGAATGTGTCACGGTGAGGGCGAGACCAGTGACGACCCGGT
AGCCACTGTCAAGGCGCGGTACGAGCGTGGCGGCGACAAGGACAAGGACGAGTTCCTGACGCCCATCATCGTCGG
CGGCGACGAGGCCAGGATCAAGGGTACGCCGTCATTGACCGGTTGACATCGGGGATGAAGCTGACCAAGTCCAAC
TTTTGATAGACGGCGACACCGTCTTCTTCTTCAACTACCGCTCAGACCGTGCGCGACAGATCACGCAGCTCCTCG
GTGACGTCGATCGGTCTGTGCTGCCCGACTTCAAGTATCCCAAGATCGCCAAGCTCGTGACCATGACCATGTACA
AGACCGACTACCCGTTCGAGGTCGCCTTTGAGCCTCAGCGAATGGAAAATGTCCTGGCTGAGTGGTTGGGCAAGC
AAAACGTCGAGCAAGTGCACATCGCCGAGACTGAAAAGTACGCCCACGTCACCTTTTTCTTCAACGGCGGCGTGG
AGAAGGTGTTTCCGCTGGAGACGCGAGACCAGGATCAGGACCTGGTGCCTTCCAACAAGTCGGTGCCGACGTACG
ACAAGGCGCCCGAGATGTCGGCGGACGGCGTGGCGGACCAGGTTTGCAAGCGGCTGGCCGAGCAGCGCTTCCCCT
TTGTCATGAACAACTTTGCTCCGCCCGACATGGTGGGCCACACGGGCGTGTACGAGGCAGCCATTGTCGGATGCG
AGGCCACGGACAAGGCCATCAAGAAGATCCTCGACGGCTGCAAGAAGGAAGGCTATATCCTCTTCATCACATCAG
ATCACGGCAACGCCGAGGAGATGAAGTTTGCCGACGGCAAGCCCAAGACGAGCCACACGACCAACAAGGTGCCTT
TTATCATGGCCAATGCCCCCGAAGGCTGGAGCCTGAAGAAGCAGGGCGGCGTGCTGGGAGACGTGGCACCGACCA
TCCTGGCAGCCATGGGCCTCCCTCAGCCCGAGGACATGACGGGCGAGTCGTTGCTCACCCGGGACCTGAAGCGTG
GCGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail